BLASTX nr result
ID: Anemarrhena21_contig00024582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00024582 (415 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008800497.1| PREDICTED: putative pentatricopeptide repeat... 71 2e-10 ref|XP_010939837.1| PREDICTED: putative pentatricopeptide repeat... 67 5e-09 ref|XP_007138164.1| hypothetical protein PHAVU_009G185600g [Phas... 63 7e-08 emb|CBI15198.3| unnamed protein product [Vitis vinifera] 63 9e-08 ref|XP_002281821.2| PREDICTED: putative pentatricopeptide repeat... 63 9e-08 ref|XP_007209177.1| hypothetical protein PRUPE_ppa006283mg [Prun... 59 1e-06 ref|XP_010089903.1| hypothetical protein L484_008591 [Morus nota... 58 3e-06 ref|XP_008239909.1| PREDICTED: putative pentatricopeptide repeat... 57 4e-06 >ref|XP_008800497.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g74400 [Phoenix dactylifera] Length = 458 Score = 71.2 bits (173), Expect = 2e-10 Identities = 40/79 (50%), Positives = 51/79 (64%) Frame = -1 Query: 238 LNTKKNHHPLFQLRLLQRKKNPSIDSYILLRALKARSNPLTYAQGIQIHQLVVTLGFQSI 59 L TKK PL Q R LQR+ SIDSY LLR L+A++ + Q+H V+TLGF+ + Sbjct: 37 LPTKK---PLEQFRRLQRRGPSSIDSYALLRVLRAQTKASSRVARTQLHTFVITLGFEPV 93 Query: 58 VFLQTALLVMYSESGHMND 2 V LQTAL+ MYSE G + D Sbjct: 94 VHLQTALIGMYSEMGSIKD 112 >ref|XP_010939837.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g74400 [Elaeis guineensis] Length = 455 Score = 67.0 bits (162), Expect = 5e-09 Identities = 34/68 (50%), Positives = 45/68 (66%) Frame = -1 Query: 205 QLRLLQRKKNPSIDSYILLRALKARSNPLTYAQGIQIHQLVVTLGFQSIVFLQTALLVMY 26 Q R +Q + SIDSY LLR L+A++ + Q+H V+TLGF+ IV LQTAL+ MY Sbjct: 45 QFRRMQSRGASSIDSYALLRVLRAQTKASSRVGKTQLHTFVITLGFEPIVHLQTALIAMY 104 Query: 25 SESGHMND 2 SE G +ND Sbjct: 105 SEVGSIND 112 >ref|XP_007138164.1| hypothetical protein PHAVU_009G185600g [Phaseolus vulgaris] gi|561011251|gb|ESW10158.1| hypothetical protein PHAVU_009G185600g [Phaseolus vulgaris] Length = 886 Score = 63.2 bits (152), Expect = 7e-08 Identities = 34/70 (48%), Positives = 50/70 (71%) Frame = -1 Query: 211 LFQLRLLQRKKNPSIDSYILLRALKARSNPLTYAQGIQIHQLVVTLGFQSIVFLQTALLV 32 LF+ L +R +IDS+ LL ALKA +N + QG Q+H L+V LG+Q+IV LQT+LL Sbjct: 580 LFRSFLRKRPTFNAIDSFSLLYALKACNNKHSSTQGKQLHTLIVKLGYQAIVQLQTSLLK 639 Query: 31 MYSESGHMND 2 +Y++SG++ D Sbjct: 640 VYAQSGNLRD 649 >emb|CBI15198.3| unnamed protein product [Vitis vinifera] Length = 948 Score = 62.8 bits (151), Expect = 9e-08 Identities = 33/79 (41%), Positives = 49/79 (62%) Frame = -1 Query: 238 LNTKKNHHPLFQLRLLQRKKNPSIDSYILLRALKARSNPLTYAQGIQIHQLVVTLGFQSI 59 L + L R+L RK SIDS+ L+ ALKA + + +G Q+H LV+ GF+ I Sbjct: 606 LQSSNTSKVLLFFRILLRKNPSSIDSFSLMFALKACTLKSSLVEGKQMHALVINFGFEPI 665 Query: 58 VFLQTALLVMYSESGHMND 2 +FLQT+L+ MYS +G++ D Sbjct: 666 IFLQTSLISMYSATGNVAD 684 >ref|XP_002281821.2| PREDICTED: putative pentatricopeptide repeat-containing protein At1g74400 [Vitis vinifera] Length = 482 Score = 62.8 bits (151), Expect = 9e-08 Identities = 33/79 (41%), Positives = 49/79 (62%) Frame = -1 Query: 238 LNTKKNHHPLFQLRLLQRKKNPSIDSYILLRALKARSNPLTYAQGIQIHQLVVTLGFQSI 59 L + L R+L RK SIDS+ L+ ALKA + + +G Q+H LV+ GF+ I Sbjct: 45 LQSSNTSKVLLFFRILLRKNPSSIDSFSLMFALKACTLKSSLVEGKQMHALVINFGFEPI 104 Query: 58 VFLQTALLVMYSESGHMND 2 +FLQT+L+ MYS +G++ D Sbjct: 105 IFLQTSLISMYSATGNVAD 123 >ref|XP_007209177.1| hypothetical protein PRUPE_ppa006283mg [Prunus persica] gi|462404912|gb|EMJ10376.1| hypothetical protein PRUPE_ppa006283mg [Prunus persica] Length = 419 Score = 58.9 bits (141), Expect = 1e-06 Identities = 32/66 (48%), Positives = 44/66 (66%) Frame = -1 Query: 199 RLLQRKKNPSIDSYILLRALKARSNPLTYAQGIQIHQLVVTLGFQSIVFLQTALLVMYSE 20 R + RK +IDSY LL LKA S +G Q+H L++ GFQSIV+LQT+L+ MYS Sbjct: 34 RDILRKSPSTIDSYTLLFVLKACSQKSLSLEGKQLHALLLKYGFQSIVYLQTSLMNMYSA 93 Query: 19 SGHMND 2 +G++ D Sbjct: 94 AGNVVD 99 >ref|XP_010089903.1| hypothetical protein L484_008591 [Morus notabilis] gi|587848284|gb|EXB38563.1| hypothetical protein L484_008591 [Morus notabilis] Length = 451 Score = 57.8 bits (138), Expect = 3e-06 Identities = 33/79 (41%), Positives = 48/79 (60%) Frame = -1 Query: 238 LNTKKNHHPLFQLRLLQRKKNPSIDSYILLRALKARSNPLTYAQGIQIHQLVVTLGFQSI 59 LN+ L R L RK P+IDSY LL LKA + + +G Q+H LV+ LGF+ + Sbjct: 47 LNSNCPTKALSLFRELLRKSLPTIDSYSLLFVLKACTQKSSSVEGKQLHALVIKLGFEHV 106 Query: 58 VFLQTALLVMYSESGHMND 2 + LQT+L+ MYS + ++ D Sbjct: 107 IHLQTSLVNMYSTTCNIVD 125 >ref|XP_008239909.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g74400 [Prunus mume] Length = 438 Score = 57.4 bits (137), Expect = 4e-06 Identities = 31/66 (46%), Positives = 43/66 (65%) Frame = -1 Query: 199 RLLQRKKNPSIDSYILLRALKARSNPLTYAQGIQIHQLVVTLGFQSIVFLQTALLVMYSE 20 R + RK +IDSY LL LKA S +G Q+H L++ GFQS+V+LQT+L+ MYS Sbjct: 53 RDILRKSPSTIDSYTLLFVLKACSQKSLSLEGKQLHALLLKYGFQSVVYLQTSLMSMYSA 112 Query: 19 SGHMND 2 +G + D Sbjct: 113 AGIVVD 118