BLASTX nr result
ID: Anemarrhena21_contig00023570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00023570 (567 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009383372.1| PREDICTED: Bowman-Birk type proteinase inhib... 46 2e-10 ref|XP_009383470.1| PREDICTED: Bowman-Birk type proteinase inhib... 44 5e-08 >ref|XP_009383372.1| PREDICTED: Bowman-Birk type proteinase inhibitor-like [Musa acuminata subsp. malaccensis] Length = 106 Score = 46.2 bits (108), Expect(2) = 2e-10 Identities = 21/33 (63%), Positives = 23/33 (69%), Gaps = 2/33 (6%) Frame = -1 Query: 438 LRLPSQA*DYG--GKKPWPCCDLCLCTRSIPLQ 346 L LPSQ G G+KPW CCD+CLCTRS P Q Sbjct: 30 LLLPSQGNGEGLAGEKPWACCDMCLCTRSFPPQ 62 Score = 46.2 bits (108), Expect(2) = 2e-10 Identities = 20/33 (60%), Positives = 22/33 (66%) Frame = -2 Query: 371 SAPDRFRCRDKLIGGCHPNCKKCQQQRELIFPP 273 S P + RC D+LIGGCHPNCK C R FPP Sbjct: 58 SFPPQCRCTDELIGGCHPNCKNCHCTRS--FPP 88 >ref|XP_009383470.1| PREDICTED: Bowman-Birk type proteinase inhibitor-like [Musa acuminata subsp. malaccensis] Length = 106 Score = 43.5 bits (101), Expect(2) = 5e-08 Identities = 19/31 (61%), Positives = 22/31 (70%), Gaps = 2/31 (6%) Frame = -1 Query: 432 LPSQA*--DYGGKKPWPCCDLCLCTRSIPLQ 346 LPSQ + GG+KPW CCD C CT+SIP Q Sbjct: 30 LPSQGIGEEVGGEKPWACCDSCSCTKSIPPQ 60 Score = 40.4 bits (93), Expect(2) = 5e-08 Identities = 18/33 (54%), Positives = 21/33 (63%) Frame = -2 Query: 371 SAPDRFRCRDKLIGGCHPNCKKCQQQRELIFPP 273 S P + RC D+LIGGC PNCK C R +PP Sbjct: 56 SIPPQCRCTDQLIGGCDPNCKTCICTRS--YPP 86