BLASTX nr result
ID: Anemarrhena21_contig00021158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00021158 (233 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011016578.1| PREDICTED: probable calcium-binding protein ... 59 2e-06 ref|XP_011006243.1| PREDICTED: probable calcium-binding protein ... 59 2e-06 ref|XP_010044322.1| PREDICTED: probable calcium-binding protein ... 58 2e-06 ref|XP_010244597.1| PREDICTED: calcium-binding protein CML42-lik... 57 4e-06 ref|XP_009414418.1| PREDICTED: probable calcium-binding protein ... 57 5e-06 ref|XP_008793406.1| PREDICTED: probable calcium-binding protein ... 57 5e-06 emb|CBI31148.3| unnamed protein product [Vitis vinifera] 56 8e-06 dbj|BAF95872.1| hypothetical protein [Vitis hybrid cultivar] 56 8e-06 ref|XP_010653101.1| PREDICTED: calcium-binding allergen Bet v 3 ... 56 8e-06 >ref|XP_011016578.1| PREDICTED: probable calcium-binding protein CML43 [Populus euphratica] Length = 195 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = -2 Query: 142 MERENTPRSFKASRSFRLHSPSLNSVRLRRVFDIFDQDSDGQITIPE 2 ME T S K S SF L SPSLNS+RLRR+FD+FD++ DG ITI E Sbjct: 1 MEAAATSASAKKSSSFSLRSPSLNSLRLRRIFDLFDKNGDGMITIQE 47 >ref|XP_011006243.1| PREDICTED: probable calcium-binding protein CML43 [Populus euphratica] Length = 195 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = -2 Query: 142 MERENTPRSFKASRSFRLHSPSLNSVRLRRVFDIFDQDSDGQITIPE 2 ME T S K S SF L SPSLNS+RLRR+FD+FD++ DG ITI E Sbjct: 1 MEAAATSASAKKSSSFSLRSPSLNSLRLRRIFDLFDKNGDGMITIQE 47 >ref|XP_010044322.1| PREDICTED: probable calcium-binding protein CML43 [Eucalyptus grandis] gi|629124039|gb|KCW88464.1| hypothetical protein EUGRSUZ_A00852 [Eucalyptus grandis] Length = 196 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -2 Query: 112 KASRSFRLHSPSLNSVRLRRVFDIFDQDSDGQITIPE 2 K S SFRLHSPSLNS+RLRR+FD+FD++ DG IT+ E Sbjct: 9 KKSASFRLHSPSLNSLRLRRIFDLFDRNGDGVITVGE 45 >ref|XP_010244597.1| PREDICTED: calcium-binding protein CML42-like [Nelumbo nucifera] Length = 206 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -2 Query: 124 PRSFKASRSFRLHSPSLNSVRLRRVFDIFDQDSDGQITIPE 2 PR ++S SFRL SPSLNS+RLRR+FD+FD++ DG IT+ E Sbjct: 11 PRLGQSSSSFRLRSPSLNSLRLRRIFDLFDKNGDGLITVEE 51 >ref|XP_009414418.1| PREDICTED: probable calcium-binding protein CML32 [Musa acuminata subsp. malaccensis] Length = 188 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 109 ASRSFRLHSPSLNSVRLRRVFDIFDQDSDGQITIPE 2 A+ SFRL S SLNSVRLRRVFD+FD++ DG+IT+PE Sbjct: 17 AAPSFRLRSTSLNSVRLRRVFDLFDRNGDGEITVPE 52 >ref|XP_008793406.1| PREDICTED: probable calcium-binding protein CML27 [Phoenix dactylifera] Length = 190 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -2 Query: 127 TPRSFKASRSFRLHSPSLNSVRLRRVFDIFDQDSDGQITIPE 2 +P + S SFRL SPSLN+VRLRRVFD+FD + DG+IT+ E Sbjct: 11 SPALHRPSPSFRLRSPSLNTVRLRRVFDLFDHNGDGEITVDE 52 >emb|CBI31148.3| unnamed protein product [Vitis vinifera] Length = 335 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -2 Query: 106 SRSFRLHSPSLNSVRLRRVFDIFDQDSDGQITIPE 2 +RSFRL PSLNSVRLRR+FD+FD++SDG IT+ E Sbjct: 177 NRSFRLRCPSLNSVRLRRIFDLFDKNSDGTITVTE 211 >dbj|BAF95872.1| hypothetical protein [Vitis hybrid cultivar] Length = 185 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -2 Query: 106 SRSFRLHSPSLNSVRLRRVFDIFDQDSDGQITIPE 2 +RSFRL PSLNSVRLRR+FD+FD++SDG IT+ E Sbjct: 8 NRSFRLRCPSLNSVRLRRIFDLFDKNSDGTITVTE 42 >ref|XP_010653101.1| PREDICTED: calcium-binding allergen Bet v 3 [Vitis vinifera] gi|239056183|emb|CAQ58618.1| calcium binding [Vitis vinifera] Length = 192 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -2 Query: 106 SRSFRLHSPSLNSVRLRRVFDIFDQDSDGQITIPE 2 +RSFRL PSLNSVRLRR+FD+FD++SDG IT+ E Sbjct: 15 NRSFRLRCPSLNSVRLRRIFDLFDKNSDGTITVTE 49