BLASTX nr result
ID: Anemarrhena21_contig00020280
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00020280 (291 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006845519.1| PREDICTED: uncharacterized protein LOC184354... 48 6e-06 >ref|XP_006845519.1| PREDICTED: uncharacterized protein LOC18435411 [Amborella trichopoda] gi|769810348|ref|XP_011623804.1| PREDICTED: uncharacterized protein LOC18435411 [Amborella trichopoda] gi|548848091|gb|ERN07194.1| hypothetical protein AMTR_s00019p00166860 [Amborella trichopoda] Length = 1050 Score = 48.1 bits (113), Expect(2) = 6e-06 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = -1 Query: 117 EVKKVMEILLRSKTRNPVLVGDSDLNLVMREVLERIER 4 EVKK+MEI+ R K RNPVLV +++ VMR++L+RIER Sbjct: 248 EVKKLMEIMCRVKKRNPVLVSENEPENVMRDLLQRIER 285 Score = 28.1 bits (61), Expect(2) = 6e-06 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -3 Query: 202 PAASMGNLYMNLRLQ**QNKEARE*YQRGSK 110 P NLY+N RLQ QN++ +E QRG + Sbjct: 218 PRPQRSNLYLNPRLQQQQNQQQQESGQRGDE 248