BLASTX nr result
ID: Anemarrhena21_contig00015451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00015451 (218 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010246627.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 64 4e-08 ref|XP_009405463.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 60 4e-07 emb|CDY23262.1| BnaA08g12840D [Brassica napus] 60 4e-07 ref|XP_007008788.1| Ubiquitin-specific protease 24 isoform 4 [Th... 60 4e-07 ref|XP_007008787.1| Ubiquitin-specific protease 24 isoform 3 [Th... 60 4e-07 ref|XP_007008785.1| Ubiquitin-specific protease 24 isoform 1 [Th... 60 4e-07 ref|XP_010557845.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 60 6e-07 ref|XP_010547327.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 60 6e-07 ref|XP_010547326.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 60 6e-07 ref|XP_010447647.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 60 6e-07 ref|XP_010438110.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 60 6e-07 ref|XP_010436320.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 60 6e-07 ref|XP_009108961.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 60 6e-07 emb|CDX68701.1| BnaC01g07520D [Brassica napus] 60 6e-07 emb|CDY36465.1| BnaC03g67850D [Brassica napus] 60 6e-07 gb|KFK29672.1| hypothetical protein AALP_AA7G163700 [Arabis alpina] 60 6e-07 gb|KDO83239.1| hypothetical protein CISIN_1g008741mg [Citrus sin... 60 6e-07 gb|KDO83238.1| hypothetical protein CISIN_1g008741mg [Citrus sin... 60 6e-07 ref|XP_006482969.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 60 6e-07 ref|XP_006345371.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 60 6e-07 >ref|XP_010246627.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like [Nelumbo nucifera] Length = 545 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 218 WLRYDDASVTAVGTNKVLHDQAYVLFYKQV 129 WLRYDDASVTAVG NKVLHDQAYVLFYKQV Sbjct: 516 WLRYDDASVTAVGVNKVLHDQAYVLFYKQV 545 >ref|XP_009405463.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like [Musa acuminata subsp. malaccensis] Length = 537 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 218 WLRYDDASVTAVGTNKVLHDQAYVLFYKQV 129 WLRYDDA+VTAV TNKVLHDQAYVLFYKQ+ Sbjct: 508 WLRYDDATVTAVTTNKVLHDQAYVLFYKQM 537 >emb|CDY23262.1| BnaA08g12840D [Brassica napus] Length = 547 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 218 WLRYDDASVTAVGTNKVLHDQAYVLFYKQV 129 WLR+DDASVTAVGT +VLHDQAYVLFYKQV Sbjct: 518 WLRFDDASVTAVGTKQVLHDQAYVLFYKQV 547 >ref|XP_007008788.1| Ubiquitin-specific protease 24 isoform 4 [Theobroma cacao] gi|508725701|gb|EOY17598.1| Ubiquitin-specific protease 24 isoform 4 [Theobroma cacao] Length = 549 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -1 Query: 218 WLRYDDASVTAVGTNKVLHDQAYVLFYKQ 132 WLR+DDASVTA+GT+KVLHDQAYVLFYKQ Sbjct: 520 WLRFDDASVTAIGTSKVLHDQAYVLFYKQ 548 >ref|XP_007008787.1| Ubiquitin-specific protease 24 isoform 3 [Theobroma cacao] gi|508725700|gb|EOY17597.1| Ubiquitin-specific protease 24 isoform 3 [Theobroma cacao] Length = 549 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -1 Query: 218 WLRYDDASVTAVGTNKVLHDQAYVLFYKQ 132 WLR+DDASVTA+GT+KVLHDQAYVLFYKQ Sbjct: 520 WLRFDDASVTAIGTSKVLHDQAYVLFYKQ 548 >ref|XP_007008785.1| Ubiquitin-specific protease 24 isoform 1 [Theobroma cacao] gi|508725698|gb|EOY17595.1| Ubiquitin-specific protease 24 isoform 1 [Theobroma cacao] Length = 548 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -1 Query: 218 WLRYDDASVTAVGTNKVLHDQAYVLFYKQ 132 WLR+DDASVTA+GT+KVLHDQAYVLFYKQ Sbjct: 519 WLRFDDASVTAIGTSKVLHDQAYVLFYKQ 547 >ref|XP_010557845.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like [Tarenaya hassleriana] gi|729420010|ref|XP_010557846.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like [Tarenaya hassleriana] Length = 548 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 218 WLRYDDASVTAVGTNKVLHDQAYVLFYKQV 129 WLR+DDASVTA+GT +VLHDQAYVLFYKQV Sbjct: 519 WLRFDDASVTAIGTKQVLHDQAYVLFYKQV 548 >ref|XP_010547327.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like isoform X2 [Tarenaya hassleriana] Length = 533 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 218 WLRYDDASVTAVGTNKVLHDQAYVLFYKQV 129 WLR+DDASVTA+GT +VLHDQAYVLFYKQV Sbjct: 504 WLRFDDASVTAIGTKQVLHDQAYVLFYKQV 533 >ref|XP_010547326.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like isoform X1 [Tarenaya hassleriana] Length = 576 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 218 WLRYDDASVTAVGTNKVLHDQAYVLFYKQV 129 WLR+DDASVTA+GT +VLHDQAYVLFYKQV Sbjct: 547 WLRFDDASVTAIGTKQVLHDQAYVLFYKQV 576 >ref|XP_010447647.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like [Camelina sativa] gi|727549767|ref|XP_010447648.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like [Camelina sativa] Length = 551 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 218 WLRYDDASVTAVGTNKVLHDQAYVLFYKQV 129 WLR+DDASVTA+GT +VLHDQAYVLFYKQV Sbjct: 522 WLRFDDASVTAIGTKQVLHDQAYVLFYKQV 551 >ref|XP_010438110.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like isoform X1 [Camelina sativa] gi|727524832|ref|XP_010438111.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like isoform X1 [Camelina sativa] gi|727524834|ref|XP_010438112.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like isoform X2 [Camelina sativa] Length = 551 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 218 WLRYDDASVTAVGTNKVLHDQAYVLFYKQV 129 WLR+DDASVTA+GT +VLHDQAYVLFYKQV Sbjct: 522 WLRFDDASVTAIGTKQVLHDQAYVLFYKQV 551 >ref|XP_010436320.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like [Camelina sativa] Length = 768 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 218 WLRYDDASVTAVGTNKVLHDQAYVLFYKQV 129 WLR+DDASVTA+GT +VLHDQAYVLFYKQV Sbjct: 739 WLRFDDASVTAIGTKQVLHDQAYVLFYKQV 768 >ref|XP_009108961.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like [Brassica rapa] Length = 569 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 218 WLRYDDASVTAVGTNKVLHDQAYVLFYKQV 129 WLR+DDASVTA+GT +VLHDQAYVLFYKQV Sbjct: 540 WLRFDDASVTAIGTKQVLHDQAYVLFYKQV 569 >emb|CDX68701.1| BnaC01g07520D [Brassica napus] Length = 597 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 218 WLRYDDASVTAVGTNKVLHDQAYVLFYKQV 129 WLR+DDASVTA+GT +VLHDQAYVLFYKQV Sbjct: 568 WLRFDDASVTAIGTKQVLHDQAYVLFYKQV 597 >emb|CDY36465.1| BnaC03g67850D [Brassica napus] Length = 587 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 218 WLRYDDASVTAVGTNKVLHDQAYVLFYKQV 129 WLR+DDASVTA+GT +VLHDQAYVLFYKQV Sbjct: 558 WLRFDDASVTAIGTKQVLHDQAYVLFYKQV 587 >gb|KFK29672.1| hypothetical protein AALP_AA7G163700 [Arabis alpina] Length = 562 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 218 WLRYDDASVTAVGTNKVLHDQAYVLFYKQV 129 WLR+DDASVTA+GT +VLHDQAYVLFYKQV Sbjct: 533 WLRFDDASVTAIGTKQVLHDQAYVLFYKQV 562 >gb|KDO83239.1| hypothetical protein CISIN_1g008741mg [Citrus sinensis] Length = 370 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 218 WLRYDDASVTAVGTNKVLHDQAYVLFYKQV 129 WL +DDASVTA+GT+KVLHDQAYVLFYKQV Sbjct: 341 WLHFDDASVTAIGTSKVLHDQAYVLFYKQV 370 >gb|KDO83238.1| hypothetical protein CISIN_1g008741mg [Citrus sinensis] Length = 555 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 218 WLRYDDASVTAVGTNKVLHDQAYVLFYKQV 129 WL +DDASVTA+GT+KVLHDQAYVLFYKQV Sbjct: 526 WLHFDDASVTAIGTSKVLHDQAYVLFYKQV 555 >ref|XP_006482969.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like [Citrus sinensis] Length = 555 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 218 WLRYDDASVTAVGTNKVLHDQAYVLFYKQV 129 WL +DDASVTA+GT+KVLHDQAYVLFYKQV Sbjct: 526 WLHFDDASVTAIGTSKVLHDQAYVLFYKQV 555 >ref|XP_006345371.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like [Solanum tuberosum] Length = 533 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 218 WLRYDDASVTAVGTNKVLHDQAYVLFYKQV 129 WLR+DDASVTAV TN+VLHDQAYVLFYKQV Sbjct: 504 WLRFDDASVTAVTTNRVLHDQAYVLFYKQV 533