BLASTX nr result
ID: Anemarrhena21_contig00012781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00012781 (246 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010923189.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 59 2e-06 >ref|XP_010923189.1| PREDICTED: peptidyl-prolyl cis-trans isomerase PASTICCINO1 [Elaeis guineensis] Length = 627 Score = 58.5 bits (140), Expect = 2e-06 Identities = 32/70 (45%), Positives = 42/70 (60%), Gaps = 5/70 (7%) Frame = -3 Query: 241 ETGEDQCPDEQSQNGEAANNYSGTAQLDGDRTLD-----YEAEKIGLLARLWPSGRRILK 77 + G+ + PDE EAA++ G L G+ D +EA+++GLL RLWP GRR Sbjct: 559 DMGDGKNPDEIEHKDEAADS-QGERSLSGNSNPDKAERVHEADQVGLLGRLWPVGRRFFT 617 Query: 76 ALGLQKCTIL 47 ALGL KCTIL Sbjct: 618 ALGLNKCTIL 627