BLASTX nr result
ID: Anemarrhena21_contig00011281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00011281 (452 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008809473.1| PREDICTED: mitochondrial import receptor sub... 58 3e-06 >ref|XP_008809473.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Phoenix dactylifera] Length = 54 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 452 AYKQLKSHLVLMGAWIAVIRVTPYVLHFLSQ 360 AYKQLK+HL +MGAW+AVIRVTPY+LH+L Q Sbjct: 15 AYKQLKTHLSIMGAWVAVIRVTPYILHYLCQ 45