BLASTX nr result
ID: Anemarrhena21_contig00008306
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00008306 (301 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008796459.1| PREDICTED: uncharacterized protein LOC103711... 58 3e-06 >ref|XP_008796459.1| PREDICTED: uncharacterized protein LOC103711919 [Phoenix dactylifera] gi|672145105|ref|XP_008796460.1| PREDICTED: uncharacterized protein LOC103711919 [Phoenix dactylifera] Length = 574 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/45 (57%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = -3 Query: 134 MGAAPDCGGPHGRGLVVADEIDDDGGA-QLMGDSMWWPPGFRFHP 3 MGAAP+C GP GR D ++D+G A +GD WWPPGFRFHP Sbjct: 1 MGAAPECRGPRGRS-GGDDGVEDEGAAGAALGDPKWWPPGFRFHP 44