BLASTX nr result
ID: Anemarrhena21_contig00008039
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00008039 (466 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009412772.1| PREDICTED: homeobox-leucine zipper protein H... 56 8e-06 >ref|XP_009412772.1| PREDICTED: homeobox-leucine zipper protein HOX6-like [Musa acuminata subsp. malaccensis] Length = 235 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/50 (54%), Positives = 32/50 (64%), Gaps = 1/50 (2%) Frame = -3 Query: 461 EEETGLLCEQPKLSSLVAS-EQQLCFHQPSWPPDQSCVTSQWWESWTMNE 315 E+E L QP +SSL +S EQQ C SWP DQSC SQWWE W ++E Sbjct: 187 EDELNLCAGQPAISSLTSSAEQQFCL-TTSWPSDQSCNNSQWWEFWPLSE 235