BLASTX nr result
ID: Anemarrhena21_contig00008002
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00008002 (652 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008812281.1| PREDICTED: late embryogenesis abundant prote... 57 8e-06 >ref|XP_008812281.1| PREDICTED: late embryogenesis abundant protein Lea5-D-like [Phoenix dactylifera] Length = 100 Score = 57.0 bits (136), Expect = 8e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -1 Query: 418 WVPDPVTGYYRPGNKRPERDAAEMRARLLSQRKTR 314 WVPDPVTGYYRPGN+R + DAAE+R RLLS R Sbjct: 66 WVPDPVTGYYRPGNRRADVDAAELRERLLSDGPRR 100