BLASTX nr result
ID: Anemarrhena21_contig00007923
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00007923 (347 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63151.1| hypothetical protein 20.t00003 [Asparagus officin... 51 2e-06 >gb|ABD63151.1| hypothetical protein 20.t00003 [Asparagus officinalis] Length = 1011 Score = 51.2 bits (121), Expect(2) = 2e-06 Identities = 25/70 (35%), Positives = 30/70 (42%) Frame = -1 Query: 284 NEIAMQTGTFMRRFMEGKSEFPAFEFRLMGWVHSSSKAWWVRMVGFVTEELRELLLRSCW 105 NE T R + E PA R GWVHS K WW RM +V E L Sbjct: 198 NEFLASASTLKNRLADLGREMPATHHRFYGWVHSLDKLWWARMTKYVLSRWSEELHACGL 257 Query: 104 YLAVKAIQYG 75 Y A+++ YG Sbjct: 258 YAAIRSTMYG 267 Score = 26.9 bits (58), Expect(2) = 2e-06 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 69 LSYYHLFPMLELYNPDTCTLFT 4 +S H F + ELYNPD+ T T Sbjct: 270 VSAKHFFALCELYNPDSNTFLT 291