BLASTX nr result
ID: Anemarrhena21_contig00006203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00006203 (848 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP57007.1| Cytochrome b6-f complex subunit, cytochrome b6 [... 60 4e-14 >emb|CDP57007.1| Cytochrome b6-f complex subunit, cytochrome b6 [Staphylococcus aureus subsp. aureus] Length = 267 Score = 60.1 bits (144), Expect(2) = 4e-14 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 177 QIELNQAAKKF*AFYYISVEISICVFLFEPYEMKFSYTVLGGG 49 QI+LN+ KKF FY ISV + VFLFE YEMKFSYTVLGGG Sbjct: 4 QIKLNEKIKKFQTFYSISVSANTWVFLFELYEMKFSYTVLGGG 46 Score = 45.8 bits (107), Expect(2) = 4e-14 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 59 LGGGSSWITYLNKVYDWFE 3 LGGGSSW TYLNKVYDWFE Sbjct: 43 LGGGSSWFTYLNKVYDWFE 61