BLASTX nr result
ID: Anemarrhena21_contig00006152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00006152 (414 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010925624.1| PREDICTED: uncharacterized protein LOC105048... 71 3e-10 >ref|XP_010925624.1| PREDICTED: uncharacterized protein LOC105048118 [Elaeis guineensis] Length = 138 Score = 70.9 bits (172), Expect = 3e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -2 Query: 221 MVSEEVGTKLLRFLYFVGAGVICTKGINLWRDY 123 MVSEEVGTKL+RFLYFVGAGVICTKGINLWRDY Sbjct: 1 MVSEEVGTKLVRFLYFVGAGVICTKGINLWRDY 33