BLASTX nr result
ID: Anemarrhena21_contig00002749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00002749 (305 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009401177.1| PREDICTED: zeaxanthin epoxidase, chloroplast... 63 7e-08 >ref|XP_009401177.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 417 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/46 (58%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Frame = -3 Query: 303 WVQQGGGSGLSGWAAKWFRDHVFYMFVQPRNMNAAL-YDCGDLPSA 169 WVQQGG +G+ WAAKWFR ++Y F+ PR + A YDCGDLP A Sbjct: 371 WVQQGGNAGVWRWAAKWFRRRIYYRFIHPRIVEAIRGYDCGDLPPA 416