BLASTX nr result
ID: Anemarrhena21_contig00000350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00000350 (416 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS51980.1| hypothetical protein TRIUR3_35160 [Triticum urartu] 57 6e-06 gb|EMT33358.1| hypothetical protein F775_04487 [Aegilops tauschii] 56 8e-06 >gb|EMS51980.1| hypothetical protein TRIUR3_35160 [Triticum urartu] Length = 126 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -3 Query: 348 KDEGREPMDYDRRARMFYESSRVFQALKERRSGDDG 241 +DEGR P DY RRAR+F ESSRVF+ LKERR GD G Sbjct: 80 EDEGRSPTDYGRRARIFEESSRVFRVLKERRDGDGG 115 >gb|EMT33358.1| hypothetical protein F775_04487 [Aegilops tauschii] Length = 137 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -3 Query: 348 KDEGREPMDYDRRARMFYESSRVFQALKERRSGDDG 241 +DEGR P DY RRA +F ESSRVF+ALKERR GD G Sbjct: 91 EDEGRSPTDYGRRAHIFEESSRVFRALKERRDGDGG 126