BLASTX nr result
ID: Alisma22_contig00040934
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00040934 (231 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAV89309.1 LOW QUALITY PROTEIN: DUF4371 domain-containing protei... 55 5e-07 KDO46324.1 hypothetical protein CISIN_1g037172mg [Citrus sinensis] 51 7e-06 GAV65735.1 Dimer_Tnp_hAT domain-containing protein/DUF4371 domai... 52 8e-06 >GAV89309.1 LOW QUALITY PROTEIN: DUF4371 domain-containing protein, partial [Cephalotus follicularis] Length = 753 Score = 55.1 bits (131), Expect = 5e-07 Identities = 22/44 (50%), Positives = 30/44 (68%) Frame = -3 Query: 184 GPCQPYNYEFPMATFGFKRHQFLQSEFDEHINWFEYSVAKYVSF 53 GPCQP N+ FP FG + +F++S F+ H W EYS+AKY +F Sbjct: 35 GPCQPRNHTFPFREFGKESRRFVESWFNLHGTWLEYSIAKYATF 78 >KDO46324.1 hypothetical protein CISIN_1g037172mg [Citrus sinensis] Length = 224 Score = 51.2 bits (121), Expect = 7e-06 Identities = 21/45 (46%), Positives = 31/45 (68%) Frame = -3 Query: 187 SGPCQPYNYEFPMATFGFKRHQFLQSEFDEHINWFEYSVAKYVSF 53 +GPCQP + FP+ FG + +F + FD++ NW EYS+AK V+F Sbjct: 41 NGPCQPKTHNFPLRHFGKQSQRFNPAWFDKYGNWLEYSIAKDVAF 85 >GAV65735.1 Dimer_Tnp_hAT domain-containing protein/DUF4371 domain-containing protein, partial [Cephalotus follicularis] Length = 753 Score = 51.6 bits (122), Expect = 8e-06 Identities = 21/44 (47%), Positives = 29/44 (65%) Frame = -3 Query: 184 GPCQPYNYEFPMATFGFKRHQFLQSEFDEHINWFEYSVAKYVSF 53 GPCQP N+ FP FG + +F++S F+ H W EYS+AK +F Sbjct: 36 GPCQPRNHTFPFREFGKESRRFVESWFNLHDTWLEYSIAKDAAF 79