BLASTX nr result
ID: Alisma22_contig00039478
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00039478 (283 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT50405.1 Pentatricopeptide repeat-containing protein At2g16880... 66 1e-10 CDP04294.1 unnamed protein product [Coffea canephora] 58 7e-08 KZM97361.1 hypothetical protein DCAR_015277 [Daucus carota subsp... 57 1e-07 XP_017247502.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 1e-07 XP_020105069.1 pentatricopeptide repeat-containing protein At2g1... 57 2e-07 XP_010272603.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 4e-07 XP_011102235.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 9e-07 XP_015062860.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 1e-06 XP_010315377.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 1e-06 XP_011102176.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 3e-06 XP_006359690.1 PREDICTED: pentatricopeptide repeat-containing pr... 52 8e-06 >JAT50405.1 Pentatricopeptide repeat-containing protein At2g16880 [Anthurium amnicola] JAT55469.1 Pentatricopeptide repeat-containing protein At2g16880 [Anthurium amnicola] Length = 806 Score = 66.2 bits (160), Expect = 1e-10 Identities = 37/73 (50%), Positives = 47/73 (64%), Gaps = 7/73 (9%) Frame = +3 Query: 6 EAPPLPPPSNLVATITSILSSNYPTSPRLSELLSPYLPHLSPALLPSIF-------SFRN 164 E PP PP LV TI +ILSS+ +SP L + L+P+LPHL PAL+PSI SF N Sbjct: 13 EPPPSPP---LVHTIAAILSSHTSSSPPLHQSLAPFLPHLEPALVPSILSAVASSPSFSN 69 Query: 165 APPASLLAFFRWW 203 PA L++F+ WW Sbjct: 70 --PAPLISFYNWW 80 >CDP04294.1 unnamed protein product [Coffea canephora] Length = 779 Score = 58.2 bits (139), Expect = 7e-08 Identities = 35/73 (47%), Positives = 47/73 (64%), Gaps = 6/73 (8%) Frame = +3 Query: 12 PPLPP--PSNLVATITSILSSNY-PTSPRLSELLSPYLPHLSPALLPSIF---SFRNAPP 173 PP P PS L+ TIT++L++ P SP S LL PYLPHL+P +L SIF + ++ P Sbjct: 6 PPNPSLNPSQLITTITNLLTTQKSPLSPPSSALLRPYLPHLTPPILHSIFTSPTLLSSHP 65 Query: 174 ASLLAFFRWWCSH 212 SLL+FF+ SH Sbjct: 66 TSLLSFFKLVQSH 78 >KZM97361.1 hypothetical protein DCAR_015277 [Daucus carota subsp. sativus] Length = 646 Score = 57.4 bits (137), Expect = 1e-07 Identities = 31/73 (42%), Positives = 45/73 (61%), Gaps = 2/73 (2%) Frame = +3 Query: 6 EAPPLPPPSNLVATITSILSSNYPTSPRLSELLSPYLPHLSPALLPSIFSFRN--APPAS 179 +APP PP+ L TIT IL+S PT+ + L+ +LPHL+P ++ SI S + + P Sbjct: 9 QAPPSQPPNKLTQTITQILTS--PTTQNPHKSLTQFLPHLTPLIILSILSSKPLLSRPDK 66 Query: 180 LLAFFRWWCSHHH 218 LL FF+W +H H Sbjct: 67 LLFFFKWTRNHSH 79 >XP_017247502.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880-like [Daucus carota subsp. sativus] XP_017247503.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880-like [Daucus carota subsp. sativus] XP_017247504.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880-like [Daucus carota subsp. sativus] XP_017247505.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880-like [Daucus carota subsp. sativus] XP_017247506.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880-like [Daucus carota subsp. sativus] Length = 780 Score = 57.4 bits (137), Expect = 1e-07 Identities = 31/73 (42%), Positives = 45/73 (61%), Gaps = 2/73 (2%) Frame = +3 Query: 6 EAPPLPPPSNLVATITSILSSNYPTSPRLSELLSPYLPHLSPALLPSIFSFRN--APPAS 179 +APP PP+ L TIT IL+S PT+ + L+ +LPHL+P ++ SI S + + P Sbjct: 9 QAPPSQPPNKLTQTITQILTS--PTTQNPHKSLTQFLPHLTPLIILSILSSKPLLSRPDK 66 Query: 180 LLAFFRWWCSHHH 218 LL FF+W +H H Sbjct: 67 LLFFFKWTRNHSH 79 >XP_020105069.1 pentatricopeptide repeat-containing protein At2g16880-like [Ananas comosus] XP_020105071.1 pentatricopeptide repeat-containing protein At2g16880-like [Ananas comosus] XP_020105072.1 pentatricopeptide repeat-containing protein At2g16880-like [Ananas comosus] XP_020105073.1 pentatricopeptide repeat-containing protein At2g16880-like [Ananas comosus] XP_020105074.1 pentatricopeptide repeat-containing protein At2g16880-like [Ananas comosus] XP_020105075.1 pentatricopeptide repeat-containing protein At2g16880-like [Ananas comosus] Length = 794 Score = 57.0 bits (136), Expect = 2e-07 Identities = 34/74 (45%), Positives = 48/74 (64%), Gaps = 8/74 (10%) Frame = +3 Query: 9 APPLPPPSNLVATITS-ILSSNYPTSPRLSELLSPYLPH--LSPALLPSIFSFRNAP--- 170 APP P + LVA ++S +L++ P+SP L+++LSP+LP LSP+LLPSI S + Sbjct: 14 APPSPEEAELVAAVSSALLAAQSPSSPPLNQVLSPFLPRLSLSPSLLPSIVSLAASSPSL 73 Query: 171 --PASLLAFFRWWC 206 P+ LL FFR C Sbjct: 74 SNPSPLLRFFRLLC 87 >XP_010272603.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Nelumbo nucifera] XP_010272610.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Nelumbo nucifera] XP_019055179.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Nelumbo nucifera] Length = 791 Score = 56.2 bits (134), Expect = 4e-07 Identities = 31/81 (38%), Positives = 51/81 (62%), Gaps = 7/81 (8%) Frame = +3 Query: 3 AEAPPLPPPS-----NLVATITSILSSNYPTSPRLSELLSPYLPHLSPALLPSIFSFRN- 164 A +PP PPPS ++ +T+IL+S+ + + L PY+PHL+P+L+ SI S + Sbjct: 4 ASSPPKPPPSPPTESEVIENVTNILTSSQASL----QSLYPYIPHLTPSLISSILSSASL 59 Query: 165 -APPASLLAFFRWWCSHHHLP 224 + P++LL+FF+W H H+P Sbjct: 60 YSRPSTLLSFFKW--CHSHIP 78 >XP_011102235.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880-like [Sesamum indicum] Length = 817 Score = 55.1 bits (131), Expect = 9e-07 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 12/82 (14%) Frame = +3 Query: 12 PPLPP----------PSNLVATITSILSSNYPTSPRLSELLSPYLPHLSPALLPSIFS-- 155 PP PP P+ LV+TIT++L S+ T+ L LSPYLP+L+P ++ SI S Sbjct: 32 PPPPPTAAIRRLLFNPTELVSTITTVLKSSNTTTSPLHAALSPYLPYLTPPVIHSILSSP 91 Query: 156 FRNAPPASLLAFFRWWCSHHHL 221 + P++LL+F W SH L Sbjct: 92 ALHHQPSALLSFLNWVHSHSTL 113 >XP_015062860.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Solanum pennellii] Length = 770 Score = 54.7 bits (130), Expect = 1e-06 Identities = 33/74 (44%), Positives = 49/74 (66%), Gaps = 2/74 (2%) Frame = +3 Query: 12 PPLPPPSNLVATITSILSSNYPTSPRLSELLSPYLPHLSPALLPSIFSFR--NAPPASLL 185 PPL P S LV TIT++LSS+ + P+ S L YLPHL+P ++ SI S ++ P++L Sbjct: 6 PPLKP-SQLVQTITTLLSSSPKSLPKSS--LQSYLPHLTPPIIHSILSSSTLSSRPSTLF 62 Query: 186 AFFRWWCSHHHLPT 227 +FF+W S H+P+ Sbjct: 63 SFFQW--SQSHIPS 74 >XP_010315377.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Solanum lycopersicum] XP_010315378.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Solanum lycopersicum] XP_019067483.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Solanum lycopersicum] XP_019067484.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Solanum lycopersicum] XP_019067485.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Solanum lycopersicum] Length = 770 Score = 54.7 bits (130), Expect = 1e-06 Identities = 33/74 (44%), Positives = 49/74 (66%), Gaps = 2/74 (2%) Frame = +3 Query: 12 PPLPPPSNLVATITSILSSNYPTSPRLSELLSPYLPHLSPALLPSIFSF--RNAPPASLL 185 PPL P S LV TIT++LSS+ + P+ S L YLPHL+P ++ SI S ++ P++L Sbjct: 6 PPLKP-SQLVQTITTLLSSSPKSLPKCS--LQSYLPHLTPPIIHSILSSPPLSSRPSTLF 62 Query: 186 AFFRWWCSHHHLPT 227 +FF+W S H+P+ Sbjct: 63 SFFQW--SQSHIPS 74 >XP_011102176.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880-like, partial [Sesamum indicum] Length = 772 Score = 53.5 bits (127), Expect = 3e-06 Identities = 29/67 (43%), Positives = 43/67 (64%), Gaps = 2/67 (2%) Frame = +3 Query: 27 PSNLVATITSILSSNYPTSPRLSELLSPYLPHLSPALLPSIFS--FRNAPPASLLAFFRW 200 P+ LV+TIT++L S+ T+ L LSPYLP+L+P ++ SI S + P++LL+F W Sbjct: 2 PTELVSTITTVLKSSNTTTSPLHAALSPYLPYLTPPVIHSILSSPALHHQPSALLSFLNW 61 Query: 201 WCSHHHL 221 SH L Sbjct: 62 VHSHSTL 68 >XP_006359690.1 PREDICTED: pentatricopeptide repeat-containing protein At2g16880 [Solanum tuberosum] Length = 770 Score = 52.4 bits (124), Expect = 8e-06 Identities = 32/74 (43%), Positives = 48/74 (64%), Gaps = 2/74 (2%) Frame = +3 Query: 12 PPLPPPSNLVATITSILSSNYPTSPRLSELLSPYLPHLSPALLPSIFS--FRNAPPASLL 185 PPL P LV TIT++LSS+ + P+ S L YLPHL+P ++ SI S ++ P++L Sbjct: 6 PPLKP-CQLVQTITTLLSSSARSLPKSS--LQSYLPHLTPPIIHSILSSPTLSSRPSTLF 62 Query: 186 AFFRWWCSHHHLPT 227 +FF+W S H+P+ Sbjct: 63 SFFQW--SQSHIPS 74