BLASTX nr result
ID: Alisma22_contig00036869
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00036869 (399 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOM56592.1 hypothetical protein LR48_Vigan10g248400 [Vigna angul... 52 4e-06 KHN06274.1 Retrovirus-related Pol polyprotein from transposon TN... 54 6e-06 >KOM56592.1 hypothetical protein LR48_Vigan10g248400 [Vigna angularis] Length = 120 Score = 52.4 bits (124), Expect = 4e-06 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Frame = -3 Query: 382 FMHNFDPKIDKPSP*ARRTFFLGYL*VQKGCNCFDTKTQW*YVSADVT-FQRTNWFLPSQ 206 F+HN P +DK SP + + FLGY +QKG C+ T+ Y+S+DVT F+ T +FL S+ Sbjct: 34 FVHNVSPGLDKLSPKSIKCVFLGYSRIQKGYRCYSPSTRRYYMSSDVTFFEDTPFFLSSK 93 >KHN06274.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 1353 Score = 54.3 bits (129), Expect = 6e-06 Identities = 29/62 (46%), Positives = 35/62 (56%) Frame = -3 Query: 382 FMHNFDPKIDKPSP*ARRTFFLGYL*VQKGCNCFDTKTQW*YVSADVTFQRTNWFLPSQ* 203 F+HN P +DK S A + FLGY +QKG CF T+ Y+SADVTF F PS Sbjct: 658 FVHNLSPGLDKLSARAIKCVFLGYSRLQKGYKCFSPSTRRYYMSADVTFFEDTPFYPSST 717 Query: 202 TH 197 H Sbjct: 718 DH 719