BLASTX nr result
ID: Alisma22_contig00034012
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00034012 (451 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT45420.1 Uncharacterized protein At5g05190 [Anthurium amnicola] 57 1e-06 XP_010104980.1 hypothetical protein L484_012064 [Morus notabilis... 55 6e-06 XP_020105284.1 uncharacterized protein LOC109721885 [Ananas como... 55 8e-06 >JAT45420.1 Uncharacterized protein At5g05190 [Anthurium amnicola] Length = 921 Score = 57.0 bits (136), Expect = 1e-06 Identities = 28/60 (46%), Positives = 33/60 (55%) Frame = +1 Query: 271 TGVSEAGNPVLVRVVRCPSCGLLLPEYAGLALYRCGGCSIPLVAKAQFSNNDILAQSEPE 450 TG + A VRVVRCP C LLPE AG ++YRCGGC L AK D ++ E Sbjct: 8 TGGATAPTAAKVRVVRCPKCQKLLPELAGFSVYRCGGCDATLQAKQAIPVTDASSEKSDE 67 >XP_010104980.1 hypothetical protein L484_012064 [Morus notabilis] EXC02937.1 hypothetical protein L484_012064 [Morus notabilis] Length = 931 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/49 (46%), Positives = 34/49 (69%) Frame = +1 Query: 304 VRVVRCPSCGLLLPEYAGLALYRCGGCSIPLVAKAQFSNNDILAQSEPE 450 VR+VRCP C LLPE ++Y+CGGC L AK ++++ND+L++ E Sbjct: 7 VRLVRCPKCDNLLPELPDYSVYQCGGCGAILRAKKRYADNDMLSEKSDE 55 >XP_020105284.1 uncharacterized protein LOC109721885 [Ananas comosus] Length = 943 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = +1 Query: 289 GNPVLVRVVRCPSCGLLLPEYAGLALYRCGGCSIPLVAK 405 G VRVVRCP+C LLPE LALYRCGGC+ L AK Sbjct: 8 GGEARVRVVRCPNCDKLLPEIPNLALYRCGGCNAALQAK 46