BLASTX nr result
ID: Alisma22_contig00011926
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00011926 (336 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011034559.1 PREDICTED: trafficking protein particle complex s... 72 4e-14 CDX87317.1 BnaA07g35560D [Brassica napus] KHF99461.1 Transport p... 70 4e-14 CDY39971.1 BnaC06g40490D [Brassica napus] 70 6e-14 KNA11243.1 hypothetical protein SOVF_136920 [Spinacia oleracea] 72 8e-14 XP_006368498.1 hypothetical protein POPTR_0001s03500g [Populus t... 72 8e-14 XP_006302980.1 hypothetical protein CARUB_v10021128mg [Capsella ... 72 8e-14 XP_015890829.1 PREDICTED: trafficking protein particle complex s... 70 1e-13 CDY29105.1 BnaC09g18310D [Brassica napus] 69 1e-13 OAY76879.1 Transport protein particle 20 kDa subunit, partial [A... 70 2e-13 XP_010057557.1 PREDICTED: trafficking protein particle complex s... 71 2e-13 XP_006398098.1 hypothetical protein EUTSA_v10001067mg [Eutrema s... 70 2e-13 XP_010042351.1 PREDICTED: trafficking protein particle complex s... 71 2e-13 KJB29969.1 hypothetical protein B456_005G125900 [Gossypium raimo... 70 2e-13 KQJ83432.1 hypothetical protein BRADI_5g14900 [Brachypodium dist... 70 2e-13 XP_018457225.1 PREDICTED: trafficking protein particle complex s... 71 2e-13 CDP08750.1 unnamed protein product [Coffea canephora] 69 2e-13 XP_020195297.1 trafficking protein particle complex subunit 2-li... 70 3e-13 XP_020105622.1 trafficking protein particle complex subunit 2-li... 70 3e-13 XP_016741851.1 PREDICTED: trafficking protein particle complex s... 70 3e-13 XP_016455687.1 PREDICTED: trafficking protein particle complex s... 70 3e-13 >XP_011034559.1 PREDICTED: trafficking protein particle complex subunit 2-like, partial [Populus euphratica] Length = 109 Score = 72.0 bits (175), Expect = 4e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 336 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 232 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL Sbjct: 75 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 109 >CDX87317.1 BnaA07g35560D [Brassica napus] KHF99461.1 Transport particle 20 kDa subunit [Gossypium arboreum] Length = 55 Score = 70.5 bits (171), Expect = 4e-14 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -1 Query: 336 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 232 ELYIKILLNPLYLPGSRI SSHFDTKVRALARKYL Sbjct: 21 ELYIKILLNPLYLPGSRITSSHFDTKVRALARKYL 55 >CDY39971.1 BnaC06g40490D [Brassica napus] Length = 55 Score = 70.1 bits (170), Expect = 6e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 336 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 232 ELYIK+LLNPLYLPGSRI SSHFDTKVRALARKYL Sbjct: 21 ELYIKVLLNPLYLPGSRITSSHFDTKVRALARKYL 55 >KNA11243.1 hypothetical protein SOVF_136920 [Spinacia oleracea] Length = 135 Score = 72.0 bits (175), Expect = 8e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 336 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 232 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL Sbjct: 101 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 135 >XP_006368498.1 hypothetical protein POPTR_0001s03500g [Populus trichocarpa] ERP65067.1 hypothetical protein POPTR_0001s03500g [Populus trichocarpa] Length = 135 Score = 72.0 bits (175), Expect = 8e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 336 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 232 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL Sbjct: 101 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 135 >XP_006302980.1 hypothetical protein CARUB_v10021128mg [Capsella rubella] EOA35878.1 hypothetical protein CARUB_v10021128mg [Capsella rubella] Length = 135 Score = 72.0 bits (175), Expect = 8e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 336 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 232 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL Sbjct: 101 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 135 >XP_015890829.1 PREDICTED: trafficking protein particle complex subunit 2 [Ziziphus jujuba] Length = 80 Score = 70.1 bits (170), Expect = 1e-13 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 336 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 232 ELYIK+LLNPLYLPGSRI SSHFDTKVRALARKYL Sbjct: 46 ELYIKVLLNPLYLPGSRITSSHFDTKVRALARKYL 80 >CDY29105.1 BnaC09g18310D [Brassica napus] Length = 55 Score = 69.3 bits (168), Expect = 1e-13 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 336 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 232 ELYIKILLNPLYLPGSRI S+HFDTKVRALARKYL Sbjct: 21 ELYIKILLNPLYLPGSRITSTHFDTKVRALARKYL 55 >OAY76879.1 Transport protein particle 20 kDa subunit, partial [Ananas comosus] Length = 106 Score = 70.5 bits (171), Expect = 2e-13 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -1 Query: 336 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 232 ELYIKILLNPLYLPGSRI SSHFDTKVRALARKYL Sbjct: 72 ELYIKILLNPLYLPGSRITSSHFDTKVRALARKYL 106 >XP_010057557.1 PREDICTED: trafficking protein particle complex subunit 2 [Eucalyptus grandis] KCW74748.1 hypothetical protein EUGRSUZ_E03470 [Eucalyptus grandis] Length = 135 Score = 71.2 bits (173), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 336 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 232 ELYIKI+LNPLYLPGSRIASSHFDTKVRALARKYL Sbjct: 101 ELYIKIILNPLYLPGSRIASSHFDTKVRALARKYL 135 >XP_006398098.1 hypothetical protein EUTSA_v10001067mg [Eutrema salsugineum] ESQ39551.1 hypothetical protein EUTSA_v10001067mg [Eutrema salsugineum] Length = 107 Score = 70.5 bits (171), Expect = 2e-13 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -1 Query: 336 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 232 ELYIKILLNPLYLPGSRI SSHFDTKVRALARKYL Sbjct: 73 ELYIKILLNPLYLPGSRITSSHFDTKVRALARKYL 107 >XP_010042351.1 PREDICTED: trafficking protein particle complex subunit 2-like, partial [Eucalyptus grandis] Length = 138 Score = 71.2 bits (173), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 336 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 232 ELYIKI+LNPLYLPGSRIASSHFDTKVRALARKYL Sbjct: 104 ELYIKIILNPLYLPGSRIASSHFDTKVRALARKYL 138 >KJB29969.1 hypothetical protein B456_005G125900 [Gossypium raimondii] Length = 110 Score = 70.5 bits (171), Expect = 2e-13 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -1 Query: 336 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 232 ELYIKILLNPLYLPGSRI SSHFDTKVRALARKYL Sbjct: 76 ELYIKILLNPLYLPGSRITSSHFDTKVRALARKYL 110 >KQJ83432.1 hypothetical protein BRADI_5g14900 [Brachypodium distachyon] Length = 112 Score = 70.5 bits (171), Expect = 2e-13 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -1 Query: 336 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 232 ELYIKI LNPLYLPGSRIASSHFDTKVRALARKYL Sbjct: 78 ELYIKIFLNPLYLPGSRIASSHFDTKVRALARKYL 112 >XP_018457225.1 PREDICTED: trafficking protein particle complex subunit 2 [Raphanus sativus] XP_018457226.1 PREDICTED: trafficking protein particle complex subunit 2 [Raphanus sativus] Length = 135 Score = 70.9 bits (172), Expect = 2e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 336 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 232 ELYIKILLNPLYLPGSRI+SSHFDTKVRALARKYL Sbjct: 101 ELYIKILLNPLYLPGSRISSSHFDTKVRALARKYL 135 >CDP08750.1 unnamed protein product [Coffea canephora] Length = 55 Score = 68.6 bits (166), Expect = 2e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -1 Query: 336 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 232 ELYIK LLNPLYLPGSRI SSHFDTKVRALARKYL Sbjct: 21 ELYIKTLLNPLYLPGSRITSSHFDTKVRALARKYL 55 >XP_020195297.1 trafficking protein particle complex subunit 2-like [Aegilops tauschii subsp. tauschii] Length = 135 Score = 70.5 bits (171), Expect = 3e-13 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -1 Query: 336 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 232 ELYIKI LNPLYLPGSRIASSHFDTKVRALARKYL Sbjct: 101 ELYIKIFLNPLYLPGSRIASSHFDTKVRALARKYL 135 >XP_020105622.1 trafficking protein particle complex subunit 2-like [Ananas comosus] XP_020105623.1 trafficking protein particle complex subunit 2-like [Ananas comosus] Length = 135 Score = 70.5 bits (171), Expect = 3e-13 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -1 Query: 336 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 232 ELYIKILLNPLYLPGSRI SSHFDTKVRALARKYL Sbjct: 101 ELYIKILLNPLYLPGSRITSSHFDTKVRALARKYL 135 >XP_016741851.1 PREDICTED: trafficking protein particle complex subunit 2-like [Gossypium hirsutum] Length = 135 Score = 70.5 bits (171), Expect = 3e-13 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -1 Query: 336 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 232 ELYIKILLNPLYLPGSRI SSHFDTKVRALARKYL Sbjct: 101 ELYIKILLNPLYLPGSRITSSHFDTKVRALARKYL 135 >XP_016455687.1 PREDICTED: trafficking protein particle complex subunit 2-like isoform X2 [Nicotiana tabacum] Length = 135 Score = 70.5 bits (171), Expect = 3e-13 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -1 Query: 336 ELYIKILLNPLYLPGSRIASSHFDTKVRALARKYL 232 ELYIKILLNPLYLPGSRI SSHFDTKVRALARKYL Sbjct: 101 ELYIKILLNPLYLPGSRITSSHFDTKVRALARKYL 135