BLASTX nr result
ID: Alisma22_contig00008799
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00008799 (1331 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008787457.1 PREDICTED: uncharacterized protein LOC103705503 [... 57 1e-07 XP_010935824.1 PREDICTED: uncharacterized protein LOC105055627 [... 55 1e-07 XP_008779079.1 PREDICTED: uncharacterized protein LOC103698807 i... 53 9e-07 XP_017696438.1 PREDICTED: uncharacterized protein LOC103698807 i... 53 9e-07 XP_017696440.1 PREDICTED: uncharacterized protein LOC103698807 i... 53 9e-07 XP_020182034.1 serine/arginine repetitive matrix protein 1-like ... 54 1e-06 XP_019711027.1 PREDICTED: protein UPSTREAM OF FLC-like isoform X... 53 2e-06 XP_019711028.1 PREDICTED: uncharacterized protein LOC105059066 i... 53 2e-06 XP_019711030.1 PREDICTED: uncharacterized protein LOC105059066 i... 53 2e-06 JAT45351.1 Beta-galactosidase, partial [Anthurium amnicola] 51 2e-06 XP_009394652.1 PREDICTED: uncharacterized protein LOC103980089 [... 50 2e-06 EMS64249.1 hypothetical protein TRIUR3_00433 [Triticum urartu] 52 4e-06 XP_018674043.1 PREDICTED: uncharacterized protein LOC103998501 [... 50 5e-06 XP_010918909.1 PREDICTED: protein UPSTREAM OF FLC [Elaeis guinee... 49 7e-06 XP_018684109.1 PREDICTED: uncharacterized protein LOC103991099 i... 51 9e-06 XP_018684111.1 PREDICTED: uncharacterized protein LOC103991099 i... 51 9e-06 XP_018684110.1 PREDICTED: protein UPSTREAM OF FLC-like isoform X... 51 9e-06 XP_003576884.1 PREDICTED: uncharacterized protein LOC100829033 i... 52 9e-06 EMT17601.1 hypothetical protein F775_25267 [Aegilops tauschii] 52 9e-06 >XP_008787457.1 PREDICTED: uncharacterized protein LOC103705503 [Phoenix dactylifera] Length = 578 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = +2 Query: 371 QQPQH*HERCQLGTKIVVAYYLCKNHHLKQPHFIEV-ISSIEGFYLK 508 QQ Q ++ Q G KI V YYLC+N HL+ PHFIEV +SS+EG YL+ Sbjct: 34 QQQQQQQQQQQQGRKIPVVYYLCRNRHLEHPHFIEVPVSSLEGLYLR 80 Score = 28.9 bits (63), Expect(2) = 1e-07 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = +3 Query: 510 YKIGFV*HEISKEDIILPAK 569 YK GFV H++S++D++LP + Sbjct: 106 YKNGFVWHDLSEDDLVLPGQ 125 >XP_010935824.1 PREDICTED: uncharacterized protein LOC105055627 [Elaeis guineensis] Length = 577 Score = 55.5 bits (132), Expect(2) = 1e-07 Identities = 27/46 (58%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Frame = +2 Query: 374 QPQH*HERCQLGTKIVVAYYLCKNHHLKQPHFIEV-ISSIEGFYLK 508 Q QH ++ Q G KI V YYLC+N HL+ PHFIEV +SS EG YL+ Sbjct: 30 QLQHHQQQQQQGRKIPVVYYLCRNRHLEHPHFIEVPVSSPEGLYLR 75 Score = 30.4 bits (67), Expect(2) = 1e-07 Identities = 11/20 (55%), Positives = 18/20 (90%) Frame = +3 Query: 510 YKIGFV*HEISKEDIILPAK 569 YK GFV H++S++D++LPA+ Sbjct: 101 YKNGFVWHDLSEDDLVLPAQ 120 >XP_008779079.1 PREDICTED: uncharacterized protein LOC103698807 isoform X1 [Phoenix dactylifera] Length = 535 Score = 53.1 bits (126), Expect(2) = 9e-07 Identities = 27/44 (61%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = +2 Query: 380 QH*HERCQLGTKIVVAYYLCKNHHLKQPHFIEV-ISSIEGFYLK 508 QH H++ Q G KI V YYLC+N HL PHFIEV +SS EG YL+ Sbjct: 34 QHHHQQ-QQGRKISVVYYLCRNRHLDPPHFIEVSVSSPEGLYLR 76 Score = 29.6 bits (65), Expect(2) = 9e-07 Identities = 10/20 (50%), Positives = 18/20 (90%) Frame = +3 Query: 510 YKIGFV*HEISKEDIILPAK 569 YK GF+ H++S++D++LPA+ Sbjct: 102 YKSGFLWHDLSEDDLVLPAQ 121 >XP_017696438.1 PREDICTED: uncharacterized protein LOC103698807 isoform X3 [Phoenix dactylifera] Length = 504 Score = 53.1 bits (126), Expect(2) = 9e-07 Identities = 27/44 (61%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = +2 Query: 380 QH*HERCQLGTKIVVAYYLCKNHHLKQPHFIEV-ISSIEGFYLK 508 QH H++ Q G KI V YYLC+N HL PHFIEV +SS EG YL+ Sbjct: 34 QHHHQQ-QQGRKISVVYYLCRNRHLDPPHFIEVSVSSPEGLYLR 76 Score = 29.6 bits (65), Expect(2) = 9e-07 Identities = 10/20 (50%), Positives = 18/20 (90%) Frame = +3 Query: 510 YKIGFV*HEISKEDIILPAK 569 YK GF+ H++S++D++LPA+ Sbjct: 102 YKSGFLWHDLSEDDLVLPAQ 121 >XP_017696440.1 PREDICTED: uncharacterized protein LOC103698807 isoform X4 [Phoenix dactylifera] Length = 428 Score = 53.1 bits (126), Expect(2) = 9e-07 Identities = 27/44 (61%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = +2 Query: 380 QH*HERCQLGTKIVVAYYLCKNHHLKQPHFIEV-ISSIEGFYLK 508 QH H++ Q G KI V YYLC+N HL PHFIEV +SS EG YL+ Sbjct: 34 QHHHQQ-QQGRKISVVYYLCRNRHLDPPHFIEVSVSSPEGLYLR 76 Score = 29.6 bits (65), Expect(2) = 9e-07 Identities = 10/20 (50%), Positives = 18/20 (90%) Frame = +3 Query: 510 YKIGFV*HEISKEDIILPAK 569 YK GF+ H++S++D++LPA+ Sbjct: 102 YKSGFLWHDLSEDDLVLPAQ 121 >XP_020182034.1 serine/arginine repetitive matrix protein 1-like [Aegilops tauschii subsp. tauschii] XP_020182036.1 serine/arginine repetitive matrix protein 1-like [Aegilops tauschii subsp. tauschii] XP_020182037.1 serine/arginine repetitive matrix protein 1-like [Aegilops tauschii subsp. tauschii] Length = 506 Score = 53.5 bits (127), Expect(2) = 1e-06 Identities = 30/72 (41%), Positives = 42/72 (58%), Gaps = 8/72 (11%) Frame = +2 Query: 317 RSGSTDRLRERNTPED-------I*QQPQH*HERCQLGTKIVVAYYLCKNHHLKQPHFIE 475 RS R R R +P + +PQ R Q GT++ V YYLC+NHHL+ PHF+E Sbjct: 7 RSAMEGRARRRASPSGMRTKAVRVEPEPQP-TRRHQPGTRVAVVYYLCRNHHLEHPHFME 65 Query: 476 V-ISSIEGFYLK 508 V ++S +G YL+ Sbjct: 66 VPLASPQGLYLR 77 Score = 28.5 bits (62), Expect(2) = 1e-06 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +3 Query: 510 YKIGFV*HEISKEDIILPAK 569 YK GFV H++S +D++LP + Sbjct: 103 YKTGFVWHDLSADDLLLPTQ 122 >XP_019711027.1 PREDICTED: protein UPSTREAM OF FLC-like isoform X1 [Elaeis guineensis] Length = 539 Score = 52.8 bits (125), Expect(2) = 2e-06 Identities = 28/47 (59%), Positives = 32/47 (68%), Gaps = 1/47 (2%) Frame = +2 Query: 371 QQPQH*HERCQLGTKIVVAYYLCKNHHLKQPHFIEV-ISSIEGFYLK 508 QQ QH Q G+KI V YYLC+N HL PHFIEV +SS EG YL+ Sbjct: 33 QQQQH----QQQGSKISVVYYLCRNRHLDHPHFIEVPVSSPEGLYLR 75 Score = 28.9 bits (63), Expect(2) = 2e-06 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = +3 Query: 510 YKIGFV*HEISKEDIILPAK 569 YK GFV H++S++D++LP + Sbjct: 101 YKNGFVWHDLSEDDLVLPVQ 120 >XP_019711028.1 PREDICTED: uncharacterized protein LOC105059066 isoform X2 [Elaeis guineensis] Length = 537 Score = 52.8 bits (125), Expect(2) = 2e-06 Identities = 28/47 (59%), Positives = 32/47 (68%), Gaps = 1/47 (2%) Frame = +2 Query: 371 QQPQH*HERCQLGTKIVVAYYLCKNHHLKQPHFIEV-ISSIEGFYLK 508 QQ QH Q G+KI V YYLC+N HL PHFIEV +SS EG YL+ Sbjct: 33 QQQQH----QQQGSKISVVYYLCRNRHLDHPHFIEVPVSSPEGLYLR 75 Score = 28.9 bits (63), Expect(2) = 2e-06 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = +3 Query: 510 YKIGFV*HEISKEDIILPAK 569 YK GFV H++S++D++LP + Sbjct: 101 YKNGFVWHDLSEDDLVLPVQ 120 >XP_019711030.1 PREDICTED: uncharacterized protein LOC105059066 isoform X4 [Elaeis guineensis] Length = 438 Score = 52.8 bits (125), Expect(2) = 2e-06 Identities = 28/47 (59%), Positives = 32/47 (68%), Gaps = 1/47 (2%) Frame = +2 Query: 371 QQPQH*HERCQLGTKIVVAYYLCKNHHLKQPHFIEV-ISSIEGFYLK 508 QQ QH Q G+KI V YYLC+N HL PHFIEV +SS EG YL+ Sbjct: 33 QQQQH----QQQGSKISVVYYLCRNRHLDHPHFIEVPVSSPEGLYLR 75 Score = 28.9 bits (63), Expect(2) = 2e-06 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = +3 Query: 510 YKIGFV*HEISKEDIILPAK 569 YK GFV H++S++D++LP + Sbjct: 101 YKNGFVWHDLSEDDLVLPVQ 120 >JAT45351.1 Beta-galactosidase, partial [Anthurium amnicola] Length = 175 Score = 51.2 bits (121), Expect(2) = 2e-06 Identities = 26/44 (59%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = +2 Query: 380 QH*HERCQLGTKIVVAYYLCKNHHLKQPHFIEV-ISSIEGFYLK 508 QH H++ Q G KI V YYLC+N HL+ PHFIEV SS EG +L+ Sbjct: 26 QHQHQQ-QQGRKIPVVYYLCRNRHLEHPHFIEVPTSSPEGLFLR 68 Score = 30.4 bits (67), Expect(2) = 2e-06 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = +3 Query: 510 YKIGFV*HEISKEDIILPA 566 YK GFV H++S++D+ILPA Sbjct: 94 YKNGFVWHDLSEDDLILPA 112 >XP_009394652.1 PREDICTED: uncharacterized protein LOC103980089 [Musa acuminata subsp. malaccensis] XP_018685618.1 PREDICTED: uncharacterized protein LOC103980089 [Musa acuminata subsp. malaccensis] XP_018685622.1 PREDICTED: uncharacterized protein LOC103980089 [Musa acuminata subsp. malaccensis] XP_018685626.1 PREDICTED: uncharacterized protein LOC103980089 [Musa acuminata subsp. malaccensis] Length = 590 Score = 50.4 bits (119), Expect(2) = 2e-06 Identities = 23/37 (62%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Frame = +2 Query: 401 QLGTKIVVAYYLCKNHHLKQPHFIEV-ISSIEGFYLK 508 Q G K+ V YYLC+N HL+ PHFIEV +SS EG YL+ Sbjct: 34 QQGRKVPVVYYLCRNRHLEHPHFIEVPLSSPEGLYLR 70 Score = 30.8 bits (68), Expect(2) = 2e-06 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 510 YKIGFV*HEISKEDIILPAK 569 YK GFV H++S++D+ILPA+ Sbjct: 96 YKNGFVWHDLSEDDLILPAQ 115 >EMS64249.1 hypothetical protein TRIUR3_00433 [Triticum urartu] Length = 491 Score = 52.0 bits (123), Expect(2) = 4e-06 Identities = 27/65 (41%), Positives = 39/65 (60%), Gaps = 1/65 (1%) Frame = +2 Query: 317 RSGSTDRLRERNTPEDI*QQPQH*HERCQLGTKIVVAYYLCKNHHLKQPHFIEV-ISSIE 493 R S +R + + QP HE LGT++ V YYLC+NH L+ PHF+EV ++S + Sbjct: 7 RRASPSGMRTKAVRVEREPQPARRHE---LGTRVAVVYYLCRNHQLEHPHFMEVQLASPQ 63 Query: 494 GFYLK 508 G YL+ Sbjct: 64 GLYLR 68 Score = 28.5 bits (62), Expect(2) = 4e-06 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +3 Query: 510 YKIGFV*HEISKEDIILPAK 569 YK GFV H++S +D++LP + Sbjct: 94 YKTGFVWHDLSADDLLLPTQ 113 >XP_018674043.1 PREDICTED: uncharacterized protein LOC103998501 [Musa acuminata subsp. malaccensis] XP_018674044.1 PREDICTED: uncharacterized protein LOC103998501 [Musa acuminata subsp. malaccensis] Length = 563 Score = 50.4 bits (119), Expect(2) = 5e-06 Identities = 24/37 (64%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Frame = +2 Query: 401 QLGTKIVVAYYLCKNHHLKQPHFIEV-ISSIEGFYLK 508 Q G KI V YYLC+N HL+ PHFIEV +SS EG YL+ Sbjct: 34 QRGGKIPVVYYLCRNRHLEHPHFIEVPLSSPEGLYLR 70 Score = 29.6 bits (65), Expect(2) = 5e-06 Identities = 11/20 (55%), Positives = 18/20 (90%) Frame = +3 Query: 510 YKIGFV*HEISKEDIILPAK 569 YK GFV H++S++D+ILP++ Sbjct: 96 YKNGFVWHDLSEDDLILPSQ 115 >XP_010918909.1 PREDICTED: protein UPSTREAM OF FLC [Elaeis guineensis] Length = 568 Score = 49.3 bits (116), Expect(2) = 7e-06 Identities = 23/35 (65%), Positives = 27/35 (77%), Gaps = 1/35 (2%) Frame = +2 Query: 407 GTKIVVAYYLCKNHHLKQPHFIEV-ISSIEGFYLK 508 G KI V YYLC+N HL+ PHFIEV I+S EG YL+ Sbjct: 40 GRKIPVVYYLCRNRHLEHPHFIEVPIASPEGLYLR 74 Score = 30.4 bits (67), Expect(2) = 7e-06 Identities = 11/19 (57%), Positives = 17/19 (89%) Frame = +3 Query: 510 YKIGFV*HEISKEDIILPA 566 YK GFV H++S++D++LPA Sbjct: 100 YKSGFVWHDLSEDDLVLPA 118 >XP_018684109.1 PREDICTED: uncharacterized protein LOC103991099 isoform X1 [Musa acuminata subsp. malaccensis] Length = 545 Score = 50.8 bits (120), Expect(2) = 9e-06 Identities = 24/37 (64%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Frame = +2 Query: 401 QLGTKIVVAYYLCKNHHLKQPHFIEV-ISSIEGFYLK 508 Q G K+ V YYLCKN HL+ PHFIEV +SS G YLK Sbjct: 33 QQGRKVPVVYYLCKNRHLEHPHFIEVLLSSPRGLYLK 69 Score = 28.5 bits (62), Expect(2) = 9e-06 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = +3 Query: 510 YKIGFV*HEISKEDIILPA 566 YK GFV H++ ++D++LPA Sbjct: 95 YKNGFVWHDLGEDDLVLPA 113 >XP_018684111.1 PREDICTED: uncharacterized protein LOC103991099 isoform X3 [Musa acuminata subsp. malaccensis] Length = 538 Score = 50.8 bits (120), Expect(2) = 9e-06 Identities = 24/37 (64%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Frame = +2 Query: 401 QLGTKIVVAYYLCKNHHLKQPHFIEV-ISSIEGFYLK 508 Q G K+ V YYLCKN HL+ PHFIEV +SS G YLK Sbjct: 33 QQGRKVPVVYYLCKNRHLEHPHFIEVLLSSPRGLYLK 69 Score = 28.5 bits (62), Expect(2) = 9e-06 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = +3 Query: 510 YKIGFV*HEISKEDIILPA 566 YK GFV H++ ++D++LPA Sbjct: 95 YKNGFVWHDLGEDDLVLPA 113 >XP_018684110.1 PREDICTED: protein UPSTREAM OF FLC-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 538 Score = 50.8 bits (120), Expect(2) = 9e-06 Identities = 24/37 (64%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Frame = +2 Query: 401 QLGTKIVVAYYLCKNHHLKQPHFIEV-ISSIEGFYLK 508 Q G K+ V YYLCKN HL+ PHFIEV +SS G YLK Sbjct: 33 QQGRKVPVVYYLCKNRHLEHPHFIEVLLSSPRGLYLK 69 Score = 28.5 bits (62), Expect(2) = 9e-06 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = +3 Query: 510 YKIGFV*HEISKEDIILPA 566 YK GFV H++ ++D++LPA Sbjct: 95 YKNGFVWHDLGEDDLVLPA 113 >XP_003576884.1 PREDICTED: uncharacterized protein LOC100829033 isoform X1 [Brachypodium distachyon] XP_010238545.1 PREDICTED: uncharacterized protein LOC100829033 isoform X1 [Brachypodium distachyon] Length = 485 Score = 52.0 bits (123), Expect(2) = 9e-06 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 7/71 (9%) Frame = +2 Query: 317 RSGSTDRLRERNTPEDI*QQPQH*------HERCQLGTKIVVAYYLCKNHHLKQPHFIEV 478 R+ R R R +P + +P ++R +LG + V YYLC+NHHL+ PHF+EV Sbjct: 6 RNAMEGRARRRASPAGLRTKPVRVQPEPPPNKRHELGKRAAVVYYLCRNHHLEHPHFMEV 65 Query: 479 -ISSIEGFYLK 508 ++S +G YL+ Sbjct: 66 PLASPQGLYLR 76 Score = 27.3 bits (59), Expect(2) = 9e-06 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = +3 Query: 507 KYKIGFV*HEISKEDIILPAK 569 +YK GFV H++S +D++ PA+ Sbjct: 101 RYKNGFVWHDLSVDDLLQPAQ 121 >EMT17601.1 hypothetical protein F775_25267 [Aegilops tauschii] Length = 309 Score = 51.6 bits (122), Expect(2) = 9e-06 Identities = 27/65 (41%), Positives = 38/65 (58%), Gaps = 1/65 (1%) Frame = +2 Query: 317 RSGSTDRLRERNTPEDI*QQPQH*HERCQLGTKIVVAYYLCKNHHLKQPHFIEV-ISSIE 493 R S R+R + + P HE GT+ V YYLC+NHHL+ PHF+EV ++S + Sbjct: 84 RRASPSRMRTKAVRVEPEPPPTRRHEP---GTRAAVVYYLCRNHHLEHPHFMEVTLASPQ 140 Query: 494 GFYLK 508 G YL+ Sbjct: 141 GLYLR 145 Score = 27.7 bits (60), Expect(2) = 9e-06 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +3 Query: 510 YKIGFV*HEISKEDIILPAK 569 YK GFV H +S +D++LP + Sbjct: 164 YKTGFVWHNLSADDLLLPTQ 183