BLASTX nr result
ID: Alisma22_contig00006640
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00006640 (332 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017220777.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-s... 64 3e-11 XP_010672140.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-s... 64 3e-11 XP_011082472.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-s... 64 4e-11 XP_011079671.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-s... 64 4e-11 XP_007163111.1 hypothetical protein PHAVU_001G207200g [Phaseolus... 63 6e-11 ONK78677.1 uncharacterized protein A4U43_C02F21290 [Asparagus of... 63 6e-11 XP_010931656.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-s... 63 6e-11 XP_020169690.1 NADH dehydrogenase [ubiquinone] iron-sulfur prote... 63 6e-11 NP_001278453.1 uncharacterized protein LOC100285915 [Zea mays] A... 63 6e-11 XP_002445704.1 hypothetical protein SORBIDRAFT_07g024460 [Sorghu... 63 6e-11 XP_010649587.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-s... 63 7e-11 EPS68051.1 hypothetical protein M569_06724, partial [Genlisea au... 63 7e-11 BAH57011.1 AT2G47690 [Arabidopsis thaliana] 62 7e-11 KNA15498.1 hypothetical protein SOVF_097010 [Spinacia oleracea] 63 8e-11 GAV66944.1 Ndufs5 domain-containing protein, partial [Cephalotus... 63 8e-11 XP_019188194.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-s... 63 9e-11 XP_003575048.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-s... 63 9e-11 CBI23001.3 unnamed protein product, partial [Vitis vinifera] 63 9e-11 XP_018444099.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-s... 62 1e-10 XP_015891880.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-s... 62 1e-10 >XP_017220777.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 5-B-like [Daucus carota subsp. sativus] KZM85509.1 hypothetical protein DCAR_027069 [Daucus carota subsp. sativus] Length = 83 Score = 63.9 bits (154), Expect = 3e-11 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 328 LLREDYLECLHHNKEFQRRNKIYKEEQRQL 239 LLREDYLECLHH+KEFQRRN+IYKEEQRQL Sbjct: 36 LLREDYLECLHHSKEFQRRNRIYKEEQRQL 65 >XP_010672140.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 5-B [Beta vulgaris subsp. vulgaris] KMT15702.1 hypothetical protein BVRB_3g056850 [Beta vulgaris subsp. vulgaris] Length = 83 Score = 63.9 bits (154), Expect = 3e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 328 LLREDYLECLHHNKEFQRRNKIYKEEQRQL 239 LLREDYLECLHH+KEFQRRNK+YKEEQRQ+ Sbjct: 36 LLREDYLECLHHSKEFQRRNKVYKEEQRQI 65 >XP_011082472.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 5-B-like [Sesamum indicum] Length = 81 Score = 63.5 bits (153), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 328 LLREDYLECLHHNKEFQRRNKIYKEEQRQL 239 LLREDYLECLHH+KEFQRRN++YKEEQRQL Sbjct: 36 LLREDYLECLHHSKEFQRRNRVYKEEQRQL 65 >XP_011079671.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 5-B-like [Sesamum indicum] Length = 81 Score = 63.5 bits (153), Expect = 4e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 328 LLREDYLECLHHNKEFQRRNKIYKEEQRQL 239 LLREDYLECLHH+KEFQRRN++YKEEQRQL Sbjct: 36 LLREDYLECLHHSKEFQRRNRVYKEEQRQL 65 >XP_007163111.1 hypothetical protein PHAVU_001G207200g [Phaseolus vulgaris] ESW35105.1 hypothetical protein PHAVU_001G207200g [Phaseolus vulgaris] Length = 82 Score = 63.2 bits (152), Expect = 6e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 328 LLREDYLECLHHNKEFQRRNKIYKEEQRQL 239 LLREDYLECLHH+KEFQRRN+IYKEEQRQ+ Sbjct: 36 LLREDYLECLHHSKEFQRRNRIYKEEQRQI 65 >ONK78677.1 uncharacterized protein A4U43_C02F21290 [Asparagus officinalis] Length = 85 Score = 63.2 bits (152), Expect = 6e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 328 LLREDYLECLHHNKEFQRRNKIYKEEQRQL 239 LLREDYLECLHH+KEFQRRN+IYKEEQRQ+ Sbjct: 36 LLREDYLECLHHSKEFQRRNRIYKEEQRQI 65 >XP_010931656.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 5-B [Elaeis guineensis] Length = 85 Score = 63.2 bits (152), Expect = 6e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 328 LLREDYLECLHHNKEFQRRNKIYKEEQRQL 239 LLREDYLECLHH+KEFQRRN+IYKEEQRQ+ Sbjct: 36 LLREDYLECLHHSKEFQRRNRIYKEEQRQI 65 >XP_020169690.1 NADH dehydrogenase [ubiquinone] iron-sulfur protein 5-B-like [Aegilops tauschii subsp. tauschii] Length = 86 Score = 63.2 bits (152), Expect = 6e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 328 LLREDYLECLHHNKEFQRRNKIYKEEQRQL 239 LLREDYLECLHH+KEFQRRN+IYKEEQRQ+ Sbjct: 36 LLREDYLECLHHSKEFQRRNRIYKEEQRQI 65 >NP_001278453.1 uncharacterized protein LOC100285915 [Zea mays] ACG26848.1 fb14 [Zea mays] ACG30730.1 fb14 [Zea mays] ACG32275.1 fb14 [Zea mays] ACG36920.1 fb14 [Zea mays] ACG40947.1 fb14 [Zea mays] ACG46741.1 fb14 [Zea mays] ACG46941.1 fb14 [Zea mays] ONM04143.1 Fb14 [Zea mays] Length = 86 Score = 63.2 bits (152), Expect = 6e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 328 LLREDYLECLHHNKEFQRRNKIYKEEQRQL 239 LLREDYLECLHH+KEFQRRN+IYKEEQRQ+ Sbjct: 36 LLREDYLECLHHSKEFQRRNRIYKEEQRQI 65 >XP_002445704.1 hypothetical protein SORBIDRAFT_07g024460 [Sorghum bicolor] EES15199.1 hypothetical protein SORBI_007G172300 [Sorghum bicolor] Length = 86 Score = 63.2 bits (152), Expect = 6e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 328 LLREDYLECLHHNKEFQRRNKIYKEEQRQL 239 LLREDYLECLHH+KEFQRRN+IYKEEQRQ+ Sbjct: 36 LLREDYLECLHHSKEFQRRNRIYKEEQRQI 65 >XP_010649587.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 5-B [Vitis vinifera] Length = 87 Score = 63.2 bits (152), Expect = 7e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 328 LLREDYLECLHHNKEFQRRNKIYKEEQRQL 239 LLREDYLECLHH+KEFQRRN+IYKEEQRQ+ Sbjct: 36 LLREDYLECLHHSKEFQRRNRIYKEEQRQI 65 >EPS68051.1 hypothetical protein M569_06724, partial [Genlisea aurea] Length = 76 Score = 62.8 bits (151), Expect = 7e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 328 LLREDYLECLHHNKEFQRRNKIYKEEQRQL 239 LLREDYLECLHH+KE+QRRN+IYKEEQRQL Sbjct: 36 LLREDYLECLHHSKEYQRRNRIYKEEQRQL 65 >BAH57011.1 AT2G47690 [Arabidopsis thaliana] Length = 62 Score = 62.4 bits (150), Expect = 7e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 328 LLREDYLECLHHNKEFQRRNKIYKEEQRQL 239 LLREDYLECLHH+KEFQRRN+IYKEEQR+L Sbjct: 15 LLREDYLECLHHSKEFQRRNRIYKEEQRKL 44 >KNA15498.1 hypothetical protein SOVF_097010 [Spinacia oleracea] Length = 82 Score = 62.8 bits (151), Expect = 8e-11 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -2 Query: 328 LLREDYLECLHHNKEFQRRNKIYKEEQRQL 239 LLREDYLECLHH+KEFQRRN++YKEEQRQ+ Sbjct: 36 LLREDYLECLHHSKEFQRRNRVYKEEQRQI 65 >GAV66944.1 Ndufs5 domain-containing protein, partial [Cephalotus follicularis] Length = 83 Score = 62.8 bits (151), Expect = 8e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -2 Query: 331 MLLREDYLECLHHNKEFQRRNKIYKEEQRQL 239 +LLREDYLECLHH+KEFQRRN+IYKEEQR+L Sbjct: 35 VLLREDYLECLHHSKEFQRRNRIYKEEQRKL 65 >XP_019188194.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 5-B [Ipomoea nil] Length = 84 Score = 62.8 bits (151), Expect = 9e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 328 LLREDYLECLHHNKEFQRRNKIYKEEQRQL 239 LLREDYLECLHH+KE+QRRN+IYKEEQRQL Sbjct: 36 LLREDYLECLHHSKEYQRRNRIYKEEQRQL 65 >XP_003575048.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 5-B-like [Brachypodium distachyon] KQJ99666.1 hypothetical protein BRADI_3g44590 [Brachypodium distachyon] Length = 86 Score = 62.8 bits (151), Expect = 9e-11 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 331 MLLREDYLECLHHNKEFQRRNKIYKEEQRQL 239 +LLREDY+ECLHH+KEFQRRN+IYKEEQRQ+ Sbjct: 35 VLLREDYMECLHHSKEFQRRNRIYKEEQRQI 65 >CBI23001.3 unnamed protein product, partial [Vitis vinifera] Length = 101 Score = 63.2 bits (152), Expect = 9e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 328 LLREDYLECLHHNKEFQRRNKIYKEEQRQL 239 LLREDYLECLHH+KEFQRRN+IYKEEQRQ+ Sbjct: 36 LLREDYLECLHHSKEFQRRNRIYKEEQRQI 65 >XP_018444099.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 5-B-like [Raphanus sativus] Length = 82 Score = 62.4 bits (150), Expect = 1e-10 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 328 LLREDYLECLHHNKEFQRRNKIYKEEQRQL 239 LLREDYLECLHH+KEFQRRN+IYKEEQR+L Sbjct: 36 LLREDYLECLHHSKEFQRRNRIYKEEQRKL 65 >XP_015891880.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 5-B [Ziziphus jujuba] Length = 82 Score = 62.4 bits (150), Expect = 1e-10 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 328 LLREDYLECLHHNKEFQRRNKIYKEEQRQL 239 LLREDYLECLHH+KEFQRRN+IYKEEQR+L Sbjct: 36 LLREDYLECLHHSKEFQRRNRIYKEEQRKL 65