BLASTX nr result
ID: Akebia27_contig00043993
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00043993 (408 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005647213.1| hypothetical protein COCSUDRAFT_33358 [Cocco... 63 5e-08 >ref|XP_005647213.1| hypothetical protein COCSUDRAFT_33358 [Coccomyxa subellipsoidea C-169] gi|384249187|gb|EIE22669.1| hypothetical protein COCSUDRAFT_33358 [Coccomyxa subellipsoidea C-169] Length = 67 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +1 Query: 118 YKVIKNDDSLEGAAKDTKGSIKGGFKDLKGEVKGAAKD 231 +K+IKNDDS+EGAAKD KG +KG FKD KGE KGA KD Sbjct: 25 WKIIKNDDSIEGAAKDVKGDLKGRFKDAKGEAKGAYKD 62