BLASTX nr result
ID: Akebia27_contig00035178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00035178 (409 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006349918.1| PREDICTED: RPM1-interacting protein 4-like [... 57 2e-06 ref|XP_004252989.1| PREDICTED: uncharacterized protein LOC101260... 57 2e-06 >ref|XP_006349918.1| PREDICTED: RPM1-interacting protein 4-like [Solanum tuberosum] Length = 313 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/84 (40%), Positives = 43/84 (51%) Frame = -2 Query: 372 DVPQVSPLQPHLNNHLQKDIPSFAGEYTKIFNKVREEGLKKQREEMQGGSAKRPVMLTDS 193 D P SP P + + D P+ A YT+IFNKVREE Q GSAK P TD+ Sbjct: 238 DTPDDSPAVPKFGDWDEND-PASAEGYTQIFNKVREE--------KQTGSAKVPSTSTDT 288 Query: 192 SYSDDHELDSRGNSMMCFCFSWGK 121 SYS+ + + C CF WG+ Sbjct: 289 SYSNSQKRYGNDSGKGCLCFPWGR 312 >ref|XP_004252989.1| PREDICTED: uncharacterized protein LOC101260623 [Solanum lycopersicum] Length = 313 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/84 (40%), Positives = 43/84 (51%) Frame = -2 Query: 372 DVPQVSPLQPHLNNHLQKDIPSFAGEYTKIFNKVREEGLKKQREEMQGGSAKRPVMLTDS 193 D P SP P + + D P+ A YT+IFNKVREE Q GSAK P TD+ Sbjct: 238 DTPDDSPAVPKFGDWDEND-PASAEGYTQIFNKVREE--------KQTGSAKVPSSSTDT 288 Query: 192 SYSDDHELDSRGNSMMCFCFSWGK 121 SYS+ + + C CF WG+ Sbjct: 289 SYSNSQKRYGNDSGKGCLCFPWGR 312