BLASTX nr result
ID: Akebia27_contig00007386
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00007386 (877 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74717.1| hypothetical protein M569_00042, partial [Genlise... 69 2e-09 >gb|EPS74717.1| hypothetical protein M569_00042, partial [Genlisea aurea] Length = 101 Score = 69.3 bits (168), Expect = 2e-09 Identities = 36/50 (72%), Positives = 40/50 (80%) Frame = +3 Query: 126 PKISVCTNDLGLYLEFPWGW*SYHGGHHSPLSALPRAIDIIRSTEIDFVE 275 PK SVCTNDLGLY +FPWG + +SPLSALPRAIDIIRST+IDF E Sbjct: 21 PKKSVCTNDLGLYSKFPWGC-TGEQLPYSPLSALPRAIDIIRSTKIDFAE 69