BLASTX nr result
ID: Akebia27_contig00001585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00001585 (431 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28297.3| unnamed protein product [Vitis vinifera] 86 2e-16 emb|CBI30323.3| unnamed protein product [Vitis vinifera] 86 2e-16 ref|XP_007147089.1| hypothetical protein PHAVU_006G095400g [Phas... 86 2e-15 ref|XP_007212200.1| hypothetical protein PRUPE_ppa012896mg [Prun... 86 2e-15 ref|NP_001236834.1| uncharacterized protein LOC100306566 [Glycin... 86 2e-15 ref|NP_001238010.1| uncharacterized protein LOC100499665 [Glycin... 86 2e-15 ref|XP_002276634.1| PREDICTED: 40S ribosomal protein S14-like [V... 86 2e-15 ref|XP_002282061.1| PREDICTED: 40S ribosomal protein S14-like [V... 86 2e-15 ref|XP_002274381.1| PREDICTED: 40S ribosomal protein S14 [Vitis ... 86 2e-15 emb|CBI30860.3| unnamed protein product [Vitis vinifera] 87 3e-15 gb|EYU35519.1| hypothetical protein MIMGU_mgv1a015653mg [Mimulus... 85 3e-15 ref|XP_007015778.1| Ribosomal protein S11 family protein [Theobr... 85 3e-15 ref|XP_007027813.1| Ribosomal protein S11 family protein isoform... 85 3e-15 ref|XP_004303536.1| PREDICTED: 40S ribosomal protein S14-2-like ... 86 4e-15 gb|AFK43992.1| unknown [Lotus japonicus] 86 4e-15 gb|AFK34399.1| unknown [Lotus japonicus] 86 4e-15 gb|EXC29377.1| 40S ribosomal protein S14-3 [Morus notabilis] 86 5e-15 gb|EXC29375.1| 40S ribosomal protein S14-3 [Morus notabilis] 86 5e-15 sp|P19950.1|RS141_MAIZE RecName: Full=40S ribosomal protein S14;... 86 5e-15 sp|P19951.1|RS142_MAIZE RecName: Full=40S ribosomal protein S14;... 86 5e-15 >emb|CBI28297.3| unnamed protein product [Vitis vinifera] Length = 191 Score = 85.9 bits (211), Expect(2) = 2e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 305 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 430 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML Sbjct: 75 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 116 Score = 25.4 bits (54), Expect(2) = 2e-16 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 265 EAMSRRKVREP 297 EAMSRRKVREP Sbjct: 40 EAMSRRKVREP 50 >emb|CBI30323.3| unnamed protein product [Vitis vinifera] Length = 163 Score = 85.9 bits (211), Expect(2) = 2e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 305 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 430 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML Sbjct: 47 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 88 Score = 25.4 bits (54), Expect(2) = 2e-16 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 265 EAMSRRKVREP 297 EAMSRRKVREP Sbjct: 12 EAMSRRKVREP 22 >ref|XP_007147089.1| hypothetical protein PHAVU_006G095400g [Phaseolus vulgaris] gi|593694750|ref|XP_007147890.1| hypothetical protein PHAVU_006G163500g [Phaseolus vulgaris] gi|593694753|ref|XP_007147891.1| hypothetical protein PHAVU_006G163600g [Phaseolus vulgaris] gi|561020312|gb|ESW19083.1| hypothetical protein PHAVU_006G095400g [Phaseolus vulgaris] gi|561021113|gb|ESW19884.1| hypothetical protein PHAVU_006G163500g [Phaseolus vulgaris] gi|561021114|gb|ESW19885.1| hypothetical protein PHAVU_006G163600g [Phaseolus vulgaris] Length = 150 Score = 85.9 bits (211), Expect(2) = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 305 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 430 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML Sbjct: 34 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 75 Score = 21.9 bits (45), Expect(2) = 2e-15 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 271 MSRRKVREP 297 MSRRKVREP Sbjct: 1 MSRRKVREP 9 >ref|XP_007212200.1| hypothetical protein PRUPE_ppa012896mg [Prunus persica] gi|462408065|gb|EMJ13399.1| hypothetical protein PRUPE_ppa012896mg [Prunus persica] Length = 150 Score = 85.9 bits (211), Expect(2) = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 305 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 430 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML Sbjct: 34 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 75 Score = 21.9 bits (45), Expect(2) = 2e-15 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 271 MSRRKVREP 297 MSRRKVREP Sbjct: 1 MSRRKVREP 9 >ref|NP_001236834.1| uncharacterized protein LOC100306566 [Glycine max] gi|255628901|gb|ACU14795.1| unknown [Glycine max] Length = 150 Score = 85.9 bits (211), Expect(2) = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 305 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 430 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML Sbjct: 34 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 75 Score = 21.9 bits (45), Expect(2) = 2e-15 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 271 MSRRKVREP 297 MSRRKVREP Sbjct: 1 MSRRKVREP 9 >ref|NP_001238010.1| uncharacterized protein LOC100499665 [Glycine max] gi|356505892|ref|XP_003521723.1| PREDICTED: 40S ribosomal protein S14-like [Glycine max] gi|356549089|ref|XP_003542930.1| PREDICTED: 40S ribosomal protein S14-like isoform X1 [Glycine max] gi|356573036|ref|XP_003554671.1| PREDICTED: 40S ribosomal protein S14-like [Glycine max] gi|356573038|ref|XP_003554672.1| PREDICTED: 40S ribosomal protein S14-like [Glycine max] gi|255625645|gb|ACU13167.1| unknown [Glycine max] gi|255641829|gb|ACU21183.1| unknown [Glycine max] Length = 150 Score = 85.9 bits (211), Expect(2) = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 305 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 430 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML Sbjct: 34 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 75 Score = 21.9 bits (45), Expect(2) = 2e-15 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 271 MSRRKVREP 297 MSRRKVREP Sbjct: 1 MSRRKVREP 9 >ref|XP_002276634.1| PREDICTED: 40S ribosomal protein S14-like [Vitis vinifera] Length = 150 Score = 85.9 bits (211), Expect(2) = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 305 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 430 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML Sbjct: 34 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 75 Score = 21.9 bits (45), Expect(2) = 2e-15 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 271 MSRRKVREP 297 MSRRKVREP Sbjct: 1 MSRRKVREP 9 >ref|XP_002282061.1| PREDICTED: 40S ribosomal protein S14-like [Vitis vinifera] Length = 150 Score = 85.9 bits (211), Expect(2) = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 305 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 430 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML Sbjct: 34 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 75 Score = 21.9 bits (45), Expect(2) = 2e-15 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 271 MSRRKVREP 297 MSRRKVREP Sbjct: 1 MSRRKVREP 9 >ref|XP_002274381.1| PREDICTED: 40S ribosomal protein S14 [Vitis vinifera] gi|147843327|emb|CAN80530.1| hypothetical protein VITISV_018475 [Vitis vinifera] Length = 150 Score = 85.9 bits (211), Expect(2) = 2e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 305 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 430 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML Sbjct: 34 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 75 Score = 21.9 bits (45), Expect(2) = 2e-15 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 271 MSRRKVREP 297 MSRRKVREP Sbjct: 1 MSRRKVREP 9 >emb|CBI30860.3| unnamed protein product [Vitis vinifera] Length = 689 Score = 86.7 bits (213), Expect = 3e-15 Identities = 50/85 (58%), Positives = 57/85 (67%), Gaps = 2/85 (2%) Frame = +2 Query: 182 SSCSWCFRRLRTNRSVQKP*LSNPSYQGKPCQGGRLGN--QXXASFNDTFIHVTDLSGRE 355 S S+ F + + R V++P N + G + ASFNDTFIHVTDLSGRE Sbjct: 530 SPSSFSFVEVMSRRKVREPKEENVTLGPTVRDGEHVFGVAHIFASFNDTFIHVTDLSGRE 589 Query: 356 TLVRITGGMKVKADRDESSPYAAML 430 TLVRITGGMKVKADRDESSPYAAML Sbjct: 590 TLVRITGGMKVKADRDESSPYAAML 614 >gb|EYU35519.1| hypothetical protein MIMGU_mgv1a015653mg [Mimulus guttatus] Length = 150 Score = 85.1 bits (209), Expect(2) = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +2 Query: 305 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 430 ASFNDTFIHVTDLSGRET+VRITGGMKVKADRDESSPYAAML Sbjct: 34 ASFNDTFIHVTDLSGRETMVRITGGMKVKADRDESSPYAAML 75 Score = 21.9 bits (45), Expect(2) = 3e-15 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 271 MSRRKVREP 297 MSRRKVREP Sbjct: 1 MSRRKVREP 9 >ref|XP_007015778.1| Ribosomal protein S11 family protein [Theobroma cacao] gi|508786141|gb|EOY33397.1| Ribosomal protein S11 family protein [Theobroma cacao] Length = 150 Score = 85.1 bits (209), Expect(2) = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +2 Query: 305 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 430 ASFNDTFIHVTDLSGRET+VRITGGMKVKADRDESSPYAAML Sbjct: 34 ASFNDTFIHVTDLSGRETMVRITGGMKVKADRDESSPYAAML 75 Score = 21.9 bits (45), Expect(2) = 3e-15 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 271 MSRRKVREP 297 MSRRKVREP Sbjct: 1 MSRRKVREP 9 >ref|XP_007027813.1| Ribosomal protein S11 family protein isoform 1 [Theobroma cacao] gi|508716418|gb|EOY08315.1| Ribosomal protein S11 family protein isoform 1 [Theobroma cacao] Length = 150 Score = 85.1 bits (209), Expect(2) = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +2 Query: 305 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 430 ASFNDTFIHVTDLSGRET+VRITGGMKVKADRDESSPYAAML Sbjct: 34 ASFNDTFIHVTDLSGRETMVRITGGMKVKADRDESSPYAAML 75 Score = 21.9 bits (45), Expect(2) = 3e-15 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 271 MSRRKVREP 297 MSRRKVREP Sbjct: 1 MSRRKVREP 9 >ref|XP_004303536.1| PREDICTED: 40S ribosomal protein S14-2-like [Fragaria vesca subsp. vesca] Length = 150 Score = 85.9 bits (211), Expect(2) = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 305 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 430 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML Sbjct: 34 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 75 Score = 20.8 bits (42), Expect(2) = 4e-15 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +1 Query: 271 MSRRKVREP 297 MS+RKVREP Sbjct: 1 MSKRKVREP 9 >gb|AFK43992.1| unknown [Lotus japonicus] Length = 150 Score = 85.9 bits (211), Expect(2) = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 305 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 430 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML Sbjct: 34 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 75 Score = 20.8 bits (42), Expect(2) = 4e-15 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +1 Query: 271 MSRRKVREP 297 MS+RKVREP Sbjct: 1 MSKRKVREP 9 >gb|AFK34399.1| unknown [Lotus japonicus] Length = 150 Score = 85.9 bits (211), Expect(2) = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 305 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 430 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML Sbjct: 34 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 75 Score = 20.8 bits (42), Expect(2) = 4e-15 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +1 Query: 271 MSRRKVREP 297 MS+RKVREP Sbjct: 1 MSKRKVREP 9 >gb|EXC29377.1| 40S ribosomal protein S14-3 [Morus notabilis] Length = 207 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 305 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 430 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML Sbjct: 74 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 115 >gb|EXC29375.1| 40S ribosomal protein S14-3 [Morus notabilis] Length = 277 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 305 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 430 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML Sbjct: 88 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 129 >sp|P19950.1|RS141_MAIZE RecName: Full=40S ribosomal protein S14; AltName: Full=Clone MCH1 Length = 149 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 305 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 430 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML Sbjct: 33 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 74 >sp|P19951.1|RS142_MAIZE RecName: Full=40S ribosomal protein S14; AltName: Full=Clone MCH2 Length = 150 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 305 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 430 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML Sbjct: 34 ASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAML 75