BLASTX nr result
ID: Akebia26_contig00035546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00035546 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278609.1| PREDICTED: geranylgeranyl transferase type-1... 57 3e-06 ref|XP_006296026.1| hypothetical protein CARUB_v10025181mg [Caps... 56 6e-06 ref|XP_004307531.1| PREDICTED: geranylgeranyl transferase type-1... 56 6e-06 ref|NP_181487.1| geranylgeranyl transferase type-1 subunit beta ... 56 6e-06 gb|AAG40865.1|AF311225_1 geranylgeranyltransferase beta subunit ... 56 6e-06 >ref|XP_002278609.1| PREDICTED: geranylgeranyl transferase type-1 subunit beta [Vitis vinifera] gi|296086228|emb|CBI31669.3| unnamed protein product [Vitis vinifera] Length = 351 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -3 Query: 78 QYGGFSKFPGQLPDLSHSYYGFTAFS 1 QYGGFSKFPGQLPDL HSYYGF+AFS Sbjct: 302 QYGGFSKFPGQLPDLYHSYYGFSAFS 327 >ref|XP_006296026.1| hypothetical protein CARUB_v10025181mg [Capsella rubella] gi|482564734|gb|EOA28924.1| hypothetical protein CARUB_v10025181mg [Capsella rubella] Length = 386 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -3 Query: 117 KLMILSFADVFVHQYGGFSKFPGQLPDLSHSYYGFTAFS 1 K+ + +F +YGGFSKFPGQLPDL HSYYG+TAFS Sbjct: 324 KIALRNFLLKCQSKYGGFSKFPGQLPDLYHSYYGYTAFS 362 >ref|XP_004307531.1| PREDICTED: geranylgeranyl transferase type-1 subunit beta-like [Fragaria vesca subsp. vesca] Length = 348 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -3 Query: 78 QYGGFSKFPGQLPDLSHSYYGFTAFS 1 +YGGFSKFPG+LPDL HSYYGFTAFS Sbjct: 299 EYGGFSKFPGELPDLYHSYYGFTAFS 324 >ref|NP_181487.1| geranylgeranyl transferase type-1 subunit beta [Arabidopsis thaliana] gi|75223214|sp|O80642.1|PGTB1_ARATH RecName: Full=Geranylgeranyl transferase type-1 subunit beta; AltName: Full=Geranylgeranyl transferase type I subunit beta; Short=AtGGT-IB; Short=GGTase-I-beta gi|3355484|gb|AAC27846.1| putative geranylgeranyl transferase type I beta subunit [Arabidopsis thaliana] gi|27311719|gb|AAO00825.1| putative geranylgeranyl transferase type I beta subunit [Arabidopsis thaliana] gi|30725602|gb|AAP37823.1| At2g39550 [Arabidopsis thaliana] gi|330254599|gb|AEC09693.1| geranylgeranyl transferase type-1 subunit beta [Arabidopsis thaliana] Length = 375 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -3 Query: 117 KLMILSFADVFVHQYGGFSKFPGQLPDLSHSYYGFTAFS 1 K+ + F +YGGFSKFPGQLPDL HSYYG+TAFS Sbjct: 313 KMALRKFLMSCQSKYGGFSKFPGQLPDLYHSYYGYTAFS 351 >gb|AAG40865.1|AF311225_1 geranylgeranyltransferase beta subunit [Arabidopsis thaliana] Length = 376 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -3 Query: 117 KLMILSFADVFVHQYGGFSKFPGQLPDLSHSYYGFTAFS 1 K+ + F +YGGFSKFPGQLPDL HSYYG+TAFS Sbjct: 314 KMALRKFLMSCQSKYGGFSKFPGQLPDLYHSYYGYTAFS 352