BLASTX nr result
ID: Akebia26_contig00025986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00025986 (273 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006373253.1| Sister chromatid cohesion 1 protein 2 [Popul... 86 7e-15 ref|XP_002509552.1| Sister chromatid cohesion 1 protein, putativ... 81 1e-13 emb|CBI40063.3| unnamed protein product [Vitis vinifera] 81 2e-13 ref|XP_002270491.1| PREDICTED: sister chromatid cohesion 1 prote... 81 2e-13 ref|XP_006470017.1| PREDICTED: sister chromatid cohesion 1 prote... 72 1e-10 ref|XP_006447122.1| hypothetical protein CICLE_v10014314mg [Citr... 72 1e-10 ref|XP_006447121.1| hypothetical protein CICLE_v10014314mg [Citr... 72 1e-10 ref|XP_002868626.1| hypothetical protein ARALYDRAFT_493894 [Arab... 72 1e-10 ref|XP_004305922.1| PREDICTED: sister chromatid cohesion 1 prote... 71 1e-10 ref|XP_007216119.1| hypothetical protein PRUPE_ppa018823mg [Prun... 70 2e-10 ref|NP_568586.2| sister chromatid cohesion 1 protein 2 [Arabidop... 70 3e-10 gb|AAG44842.1|AF281154_1 cohesion family protein SYN2 [Arabidops... 70 3e-10 dbj|BAB11346.1| unnamed protein product [Arabidopsis thaliana] 70 3e-10 ref|NP_851110.1| sister chromatid cohesion 1 protein 2 [Arabidop... 70 3e-10 ref|XP_004159806.1| PREDICTED: uncharacterized protein LOC101227... 70 4e-10 ref|XP_007019637.1| Rad21/Rec8-like family protein isoform 3 [Th... 69 5e-10 ref|XP_007019636.1| Rad21/Rec8-like family protein isoform 2 [Th... 69 5e-10 ref|XP_007019635.1| Rad21/Rec8-like family protein isoform 1 [Th... 69 5e-10 ref|XP_006405422.1| hypothetical protein EUTSA_v10027644mg [Eutr... 66 6e-09 gb|EXC31357.1| Sister chromatid cohesion 1 protein 2 [Morus nota... 65 1e-08 >ref|XP_006373253.1| Sister chromatid cohesion 1 protein 2 [Populus trichocarpa] gi|550319959|gb|ERP51050.1| Sister chromatid cohesion 1 protein 2 [Populus trichocarpa] Length = 770 Score = 85.5 bits (210), Expect = 7e-15 Identities = 39/71 (54%), Positives = 51/71 (71%) Frame = -1 Query: 213 IYSKKVEYLYHDCNKCLSKLTTYALSGKDNSTIEPMGESKFSITLPDKFELDSFNLDIME 34 IYSKKVEYL+ DCNK L + + L KD +E + FSITLP++FELD+F+L+I+E Sbjct: 67 IYSKKVEYLFDDCNKVLLNVKDFVLCNKDGILVETLQAPYFSITLPERFELDAFDLEIIE 126 Query: 33 DMSGGNVKPHQ 1 D GGNV PH+ Sbjct: 127 DTIGGNVMPHE 137 >ref|XP_002509552.1| Sister chromatid cohesion 1 protein, putative [Ricinus communis] gi|223549451|gb|EEF50939.1| Sister chromatid cohesion 1 protein, putative [Ricinus communis] Length = 781 Score = 81.3 bits (199), Expect = 1e-13 Identities = 37/71 (52%), Positives = 53/71 (74%) Frame = -1 Query: 213 IYSKKVEYLYHDCNKCLSKLTTYALSGKDNSTIEPMGESKFSITLPDKFELDSFNLDIME 34 I+SKKVEYL+ DCNK L K+ + + K+ + +E + SITLP++FELD+FNL+I+E Sbjct: 67 IFSKKVEYLFDDCNKVLLKIKDFMVRNKERALMETLCAPYSSITLPERFELDAFNLEIIE 126 Query: 33 DMSGGNVKPHQ 1 D+SGGNV P + Sbjct: 127 DISGGNVVPSE 137 >emb|CBI40063.3| unnamed protein product [Vitis vinifera] Length = 621 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/71 (52%), Positives = 52/71 (73%) Frame = -1 Query: 213 IYSKKVEYLYHDCNKCLSKLTTYALSGKDNSTIEPMGESKFSITLPDKFELDSFNLDIME 34 IYSKKVEYL+ DC K L K+ +A+ + N+ +E FSITLP FELD+F+L+++E Sbjct: 67 IYSKKVEYLFDDCQKMLIKVKDFAVGKQFNADMEGFSAPCFSITLPKTFELDAFDLEVLE 126 Query: 33 DMSGGNVKPHQ 1 D+SGGNV+P + Sbjct: 127 DVSGGNVRPQE 137 >ref|XP_002270491.1| PREDICTED: sister chromatid cohesion 1 protein 2-like [Vitis vinifera] Length = 756 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/71 (52%), Positives = 52/71 (73%) Frame = -1 Query: 213 IYSKKVEYLYHDCNKCLSKLTTYALSGKDNSTIEPMGESKFSITLPDKFELDSFNLDIME 34 IYSKKVEYL+ DC K L K+ +A+ + N+ +E FSITLP FELD+F+L+++E Sbjct: 234 IYSKKVEYLFDDCQKMLIKVKDFAVGKQFNADMEGFSAPCFSITLPKTFELDAFDLEVLE 293 Query: 33 DMSGGNVKPHQ 1 D+SGGNV+P + Sbjct: 294 DVSGGNVRPQE 304 >ref|XP_006470017.1| PREDICTED: sister chromatid cohesion 1 protein 2-like isoform X2 [Citrus sinensis] Length = 775 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/69 (49%), Positives = 46/69 (66%) Frame = -1 Query: 213 IYSKKVEYLYHDCNKCLSKLTTYALSGKDNSTIEPMGESKFSITLPDKFELDSFNLDIME 34 IYSKKVEYL+ DCN + K+ + +S K + + SITLP+ FELD+F+L+I+E Sbjct: 67 IYSKKVEYLFDDCNDAVVKINNFLVSEKSMKNLGNLCAPYCSITLPESFELDAFDLEILE 126 Query: 33 DMSGGNVKP 7 DMSG N P Sbjct: 127 DMSGENAVP 135 >ref|XP_006447122.1| hypothetical protein CICLE_v10014314mg [Citrus clementina] gi|568831532|ref|XP_006470016.1| PREDICTED: sister chromatid cohesion 1 protein 2-like isoform X1 [Citrus sinensis] gi|557549733|gb|ESR60362.1| hypothetical protein CICLE_v10014314mg [Citrus clementina] Length = 802 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/69 (49%), Positives = 46/69 (66%) Frame = -1 Query: 213 IYSKKVEYLYHDCNKCLSKLTTYALSGKDNSTIEPMGESKFSITLPDKFELDSFNLDIME 34 IYSKKVEYL+ DCN + K+ + +S K + + SITLP+ FELD+F+L+I+E Sbjct: 67 IYSKKVEYLFDDCNDAVVKINNFLVSEKSMKNLGNLCAPYCSITLPESFELDAFDLEILE 126 Query: 33 DMSGGNVKP 7 DMSG N P Sbjct: 127 DMSGENAVP 135 >ref|XP_006447121.1| hypothetical protein CICLE_v10014314mg [Citrus clementina] gi|557549732|gb|ESR60361.1| hypothetical protein CICLE_v10014314mg [Citrus clementina] Length = 724 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/69 (49%), Positives = 46/69 (66%) Frame = -1 Query: 213 IYSKKVEYLYHDCNKCLSKLTTYALSGKDNSTIEPMGESKFSITLPDKFELDSFNLDIME 34 IYSKKVEYL+ DCN + K+ + +S K + + SITLP+ FELD+F+L+I+E Sbjct: 67 IYSKKVEYLFDDCNDAVVKINNFLVSEKSMKNLGNLCAPYCSITLPESFELDAFDLEILE 126 Query: 33 DMSGGNVKP 7 DMSG N P Sbjct: 127 DMSGENAVP 135 >ref|XP_002868626.1| hypothetical protein ARALYDRAFT_493894 [Arabidopsis lyrata subsp. lyrata] gi|297314462|gb|EFH44885.1| hypothetical protein ARALYDRAFT_493894 [Arabidopsis lyrata subsp. lyrata] Length = 805 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/74 (47%), Positives = 47/74 (63%), Gaps = 3/74 (4%) Frame = -1 Query: 213 IYSKKVEYLYHDCNKCLSKLTTYALSGKDNSTIE---PMGESKFSITLPDKFELDSFNLD 43 IYSKKV++L+ DCNK L + + K+ P FSI LP++FELD+F+L Sbjct: 67 IYSKKVDFLFDDCNKALIGVKEFVAKEKNREKTGVSLPASIECFSIALPERFELDAFDLG 126 Query: 42 IMEDMSGGNVKPHQ 1 I+ED GGNVKPH+ Sbjct: 127 ILEDFHGGNVKPHE 140 >ref|XP_004305922.1| PREDICTED: sister chromatid cohesion 1 protein 2-like [Fragaria vesca subsp. vesca] Length = 560 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/71 (43%), Positives = 50/71 (70%) Frame = -1 Query: 213 IYSKKVEYLYHDCNKCLSKLTTYALSGKDNSTIEPMGESKFSITLPDKFELDSFNLDIME 34 IYSKKVEYL+ DC+ L+++ + +S K+ + + S+TLP++FELD+F+ I+E Sbjct: 67 IYSKKVEYLFDDCHDVLTEINKFVVSTKEKEDTDTLRAPYDSVTLPERFELDAFDFGILE 126 Query: 33 DMSGGNVKPHQ 1 D+SGGNV ++ Sbjct: 127 DVSGGNVVSYE 137 >ref|XP_007216119.1| hypothetical protein PRUPE_ppa018823mg [Prunus persica] gi|462412269|gb|EMJ17318.1| hypothetical protein PRUPE_ppa018823mg [Prunus persica] Length = 699 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/66 (50%), Positives = 49/66 (74%), Gaps = 2/66 (3%) Frame = -1 Query: 213 IYSKKVEYLYHDCNKCLSKLTTYALSGKDNSTIEPMGESKFSITLPDKFELDSFNLDIM- 37 IYSKKVEYL++DCN+ L K+ + +S K N+ + + +S+TLPD+FELD+F+L I+ Sbjct: 67 IYSKKVEYLFNDCNEVLIKINKFVVSTKKNADADKLRAPYYSVTLPDRFELDAFDLGILE 126 Query: 36 -EDMSG 22 ED+SG Sbjct: 127 VEDVSG 132 >ref|NP_568586.2| sister chromatid cohesion 1 protein 2 [Arabidopsis thaliana] gi|30913286|sp|Q9FQ20.2|SCC12_ARATH RecName: Full=Sister chromatid cohesion 1 protein 2; AltName: Full=SCC1 homolog 2; Short=AtRAD21-1 gi|18157643|gb|AAL62057.1|AF400126_1 RAD21-1 variant 1 [Arabidopsis thaliana] gi|332007220|gb|AED94603.1| cohesion family protein SYN2 (SYN2) [Arabidopsis thaliana] Length = 810 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/74 (44%), Positives = 47/74 (63%), Gaps = 3/74 (4%) Frame = -1 Query: 213 IYSKKVEYLYHDCNKCLSKLTTYALSGKDNSTIE---PMGESKFSITLPDKFELDSFNLD 43 IYSKKV++L+ DCNK L + + ++ P FSI LP++FELD+F+L Sbjct: 67 IYSKKVDFLFDDCNKALIGVKEFVAKERNREKTGVSLPASIECFSIALPERFELDAFDLG 126 Query: 42 IMEDMSGGNVKPHQ 1 ++ED GGNVKPH+ Sbjct: 127 VLEDFHGGNVKPHE 140 >gb|AAG44842.1|AF281154_1 cohesion family protein SYN2 [Arabidopsis thaliana] Length = 809 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/74 (44%), Positives = 47/74 (63%), Gaps = 3/74 (4%) Frame = -1 Query: 213 IYSKKVEYLYHDCNKCLSKLTTYALSGKDNSTIE---PMGESKFSITLPDKFELDSFNLD 43 IYSKKV++L+ DCNK L + + ++ P FSI LP++FELD+F+L Sbjct: 67 IYSKKVDFLFDDCNKALIGVKEFVAKERNREKTGVSLPASIECFSIALPERFELDAFDLG 126 Query: 42 IMEDMSGGNVKPHQ 1 ++ED GGNVKPH+ Sbjct: 127 VLEDFHGGNVKPHE 140 >dbj|BAB11346.1| unnamed protein product [Arabidopsis thaliana] Length = 901 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/74 (44%), Positives = 47/74 (63%), Gaps = 3/74 (4%) Frame = -1 Query: 213 IYSKKVEYLYHDCNKCLSKLTTYALSGKDNSTIE---PMGESKFSITLPDKFELDSFNLD 43 IYSKKV++L+ DCNK L + + ++ P FSI LP++FELD+F+L Sbjct: 67 IYSKKVDFLFDDCNKALIGVKEFVAKERNREKTGVSLPASIECFSIALPERFELDAFDLG 126 Query: 42 IMEDMSGGNVKPHQ 1 ++ED GGNVKPH+ Sbjct: 127 VLEDFHGGNVKPHE 140 >ref|NP_851110.1| sister chromatid cohesion 1 protein 2 [Arabidopsis thaliana] gi|18157645|gb|AAL62058.1|AF400127_1 RAD21-1 variant 2 [Arabidopsis thaliana] gi|332007219|gb|AED94602.1| cohesion family protein SYN2 (SYN2) [Arabidopsis thaliana] Length = 809 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/74 (44%), Positives = 47/74 (63%), Gaps = 3/74 (4%) Frame = -1 Query: 213 IYSKKVEYLYHDCNKCLSKLTTYALSGKDNSTIE---PMGESKFSITLPDKFELDSFNLD 43 IYSKKV++L+ DCNK L + + ++ P FSI LP++FELD+F+L Sbjct: 67 IYSKKVDFLFDDCNKALIGVKEFVAKERNREKTGVSLPASIECFSIALPERFELDAFDLG 126 Query: 42 IMEDMSGGNVKPHQ 1 ++ED GGNVKPH+ Sbjct: 127 VLEDFHGGNVKPHE 140 >ref|XP_004159806.1| PREDICTED: uncharacterized protein LOC101227114 [Cucumis sativus] Length = 320 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/71 (43%), Positives = 49/71 (69%) Frame = -1 Query: 213 IYSKKVEYLYHDCNKCLSKLTTYALSGKDNSTIEPMGESKFSITLPDKFELDSFNLDIME 34 IYSKKVEYLY DCNK L+++ + + K+++ ++ITLP++FELD F+L I+E Sbjct: 67 IYSKKVEYLYTDCNKVLTEINEFVVRTKNSTRKGTKQTPYYAITLPERFELDEFDLGIIE 126 Query: 33 DMSGGNVKPHQ 1 D++G + H+ Sbjct: 127 DLTGSHTVSHE 137 >ref|XP_007019637.1| Rad21/Rec8-like family protein isoform 3 [Theobroma cacao] gi|508724965|gb|EOY16862.1| Rad21/Rec8-like family protein isoform 3 [Theobroma cacao] Length = 797 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/71 (45%), Positives = 47/71 (66%) Frame = -1 Query: 213 IYSKKVEYLYHDCNKCLSKLTTYALSGKDNSTIEPMGESKFSITLPDKFELDSFNLDIME 34 IYSKKVEYL+ DC + L K+ + + K+ + E + FSIT P F+LD+F+L+I+E Sbjct: 67 IYSKKVEYLFDDCQEVLIKINEFVVREKNRAKKEALRARCFSITRPVSFDLDAFDLEILE 126 Query: 33 DMSGGNVKPHQ 1 + SG N PH+ Sbjct: 127 ETSGDNAVPHE 137 >ref|XP_007019636.1| Rad21/Rec8-like family protein isoform 2 [Theobroma cacao] gi|508724964|gb|EOY16861.1| Rad21/Rec8-like family protein isoform 2 [Theobroma cacao] Length = 856 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/71 (45%), Positives = 47/71 (66%) Frame = -1 Query: 213 IYSKKVEYLYHDCNKCLSKLTTYALSGKDNSTIEPMGESKFSITLPDKFELDSFNLDIME 34 IYSKKVEYL+ DC + L K+ + + K+ + E + FSIT P F+LD+F+L+I+E Sbjct: 67 IYSKKVEYLFDDCQEVLIKINEFVVREKNRAKKEALRARCFSITRPVSFDLDAFDLEILE 126 Query: 33 DMSGGNVKPHQ 1 + SG N PH+ Sbjct: 127 ETSGDNAVPHE 137 >ref|XP_007019635.1| Rad21/Rec8-like family protein isoform 1 [Theobroma cacao] gi|508724963|gb|EOY16860.1| Rad21/Rec8-like family protein isoform 1 [Theobroma cacao] Length = 887 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/71 (45%), Positives = 47/71 (66%) Frame = -1 Query: 213 IYSKKVEYLYHDCNKCLSKLTTYALSGKDNSTIEPMGESKFSITLPDKFELDSFNLDIME 34 IYSKKVEYL+ DC + L K+ + + K+ + E + FSIT P F+LD+F+L+I+E Sbjct: 67 IYSKKVEYLFDDCQEVLIKINEFVVREKNRAKKEALRARCFSITRPVSFDLDAFDLEILE 126 Query: 33 DMSGGNVKPHQ 1 + SG N PH+ Sbjct: 127 ETSGDNAVPHE 137 >ref|XP_006405422.1| hypothetical protein EUTSA_v10027644mg [Eutrema salsugineum] gi|557106560|gb|ESQ46875.1| hypothetical protein EUTSA_v10027644mg [Eutrema salsugineum] Length = 816 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/74 (44%), Positives = 49/74 (66%), Gaps = 3/74 (4%) Frame = -1 Query: 213 IYSKKVEYLYHDCNKCLSKLTTYALSGK--DNSTIEPMGESKF-SITLPDKFELDSFNLD 43 IYSKKV++L+ DCNK L + + K +N+ + G + F SI LP+ FELD+F+L Sbjct: 67 IYSKKVDFLFDDCNKALIGVKEFVAKEKNRENTNVPLPGSTGFLSIDLPECFELDAFDLG 126 Query: 42 IMEDMSGGNVKPHQ 1 +++D GGNVKP + Sbjct: 127 VLDDFHGGNVKPQE 140 >gb|EXC31357.1| Sister chromatid cohesion 1 protein 2 [Morus notabilis] Length = 900 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/73 (41%), Positives = 48/73 (65%), Gaps = 2/73 (2%) Frame = -1 Query: 213 IYSKKVEYLYHDCNKCLSKLTTYALSGKDNSTIEPMGESKFSITLPDKFELDSFNLDIM- 37 IYSKKVEYL+ DC + L + + + ++ ++ F+ITLP+ FELD+F+L+++ Sbjct: 66 IYSKKVEYLFEDCQEVLIGVNNFVVHTIEDLPLDTQRAPYFAITLPETFELDAFDLEVLD 125 Query: 36 -EDMSGGNVKPHQ 1 +D GGNV PH+ Sbjct: 126 VDDAIGGNVLPHE 138