BLASTX nr result
ID: Akebia26_contig00023561
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00023561 (452 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007035425.1| Squamosa promoter binding protein-like 7, pu... 39 4e-06 >ref|XP_007035425.1| Squamosa promoter binding protein-like 7, putative [Theobroma cacao] gi|508714454|gb|EOY06351.1| Squamosa promoter binding protein-like 7, putative [Theobroma cacao] Length = 807 Score = 38.9 bits (89), Expect(2) = 4e-06 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -3 Query: 339 MCCFLLHPPKVGEFVVSIHRCLF 271 MC L HP KVGEF V+I RCLF Sbjct: 778 MCAVLFHPNKVGEFAVTIRRCLF 800 Score = 37.4 bits (85), Expect(2) = 4e-06 Identities = 19/40 (47%), Positives = 25/40 (62%) Frame = -1 Query: 449 LGKIWPKKFGGCSISSTILGSRSLVLMLATATVCFGICAV 330 L K P+K ++T L SR VL+LATA +C G+CAV Sbjct: 742 LNKECPRKSCSPIFTATTLRSRPAVLILATAAICLGMCAV 781