BLASTX nr result
ID: Akebia26_contig00014635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00014635 (1078 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007035472.1| Tubby-like F-box protein 3 isoform 1 [Theobr... 63 2e-07 ref|XP_002882466.1| hypothetical protein ARALYDRAFT_477941 [Arab... 61 9e-07 gb|EYU43889.1| hypothetical protein MIMGU_mgv1a007913mg [Mimulus... 59 4e-06 gb|EYU43888.1| hypothetical protein MIMGU_mgv1a007913mg [Mimulus... 59 4e-06 ref|XP_006297896.1| hypothetical protein CARUB_v10013937mg [Caps... 59 4e-06 ref|XP_006407954.1| hypothetical protein EUTSA_v10020909mg [Eutr... 59 4e-06 ref|XP_007050787.1| Tubby like protein 3 isoform 2 [Theobroma ca... 59 5e-06 ref|XP_007050786.1| Tubby like protein 3 isoform 1 [Theobroma ca... 59 5e-06 >ref|XP_007035472.1| Tubby-like F-box protein 3 isoform 1 [Theobroma cacao] gi|508714501|gb|EOY06398.1| Tubby-like F-box protein 3 isoform 1 [Theobroma cacao] Length = 397 Score = 62.8 bits (151), Expect = 2e-07 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = +1 Query: 946 LKIYLQRNFLNHCLQPGPRDSLLQCFIKRNRNTHTYYLYLGLT 1074 +K R + CLQPGP+D LLQCFIKRNR+T TY+LYLGLT Sbjct: 94 VKQQFTRKLVLDCLQPGPKDCLLQCFIKRNRSTQTYHLYLGLT 136 >ref|XP_002882466.1| hypothetical protein ARALYDRAFT_477941 [Arabidopsis lyrata subsp. lyrata] gi|297328306|gb|EFH58725.1| hypothetical protein ARALYDRAFT_477941 [Arabidopsis lyrata subsp. lyrata] Length = 382 Score = 60.8 bits (146), Expect = 9e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 988 QPGPRDSLLQCFIKRNRNTHTYYLYLGLT 1074 QPGPRDSL+QCFIKRNRNT +YYLYLGLT Sbjct: 97 QPGPRDSLVQCFIKRNRNTQSYYLYLGLT 125 >gb|EYU43889.1| hypothetical protein MIMGU_mgv1a007913mg [Mimulus guttatus] Length = 388 Score = 58.9 bits (141), Expect = 4e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 988 QPGPRDSLLQCFIKRNRNTHTYYLYLGLTQ 1077 QPGPR+SL+QCFIKRNR THTYYLY+ L+Q Sbjct: 112 QPGPRESLMQCFIKRNRTTHTYYLYVSLSQ 141 >gb|EYU43888.1| hypothetical protein MIMGU_mgv1a007913mg [Mimulus guttatus] Length = 391 Score = 58.9 bits (141), Expect = 4e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 988 QPGPRDSLLQCFIKRNRNTHTYYLYLGLTQ 1077 QPGPR+SL+QCFIKRNR THTYYLY+ L+Q Sbjct: 112 QPGPRESLMQCFIKRNRTTHTYYLYVSLSQ 141 >ref|XP_006297896.1| hypothetical protein CARUB_v10013937mg [Capsella rubella] gi|482566605|gb|EOA30794.1| hypothetical protein CARUB_v10013937mg [Capsella rubella] Length = 382 Score = 58.9 bits (141), Expect = 4e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +1 Query: 988 QPGPRDSLLQCFIKRNRNTHTYYLYLGLT 1074 QPGPRDSL+QCFIKRNRNT +Y+LYLGLT Sbjct: 94 QPGPRDSLVQCFIKRNRNTQSYHLYLGLT 122 >ref|XP_006407954.1| hypothetical protein EUTSA_v10020909mg [Eutrema salsugineum] gi|312282273|dbj|BAJ34002.1| unnamed protein product [Thellungiella halophila] gi|557109100|gb|ESQ49407.1| hypothetical protein EUTSA_v10020909mg [Eutrema salsugineum] Length = 383 Score = 58.9 bits (141), Expect = 4e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +1 Query: 988 QPGPRDSLLQCFIKRNRNTHTYYLYLGLT 1074 QPGPRDSL+QCFIKRNRNT +Y+LYLGLT Sbjct: 97 QPGPRDSLVQCFIKRNRNTQSYHLYLGLT 125 >ref|XP_007050787.1| Tubby like protein 3 isoform 2 [Theobroma cacao] gi|508703048|gb|EOX94944.1| Tubby like protein 3 isoform 2 [Theobroma cacao] Length = 402 Score = 58.5 bits (140), Expect = 5e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 988 QPGPRDSLLQCFIKRNRNTHTYYLYLGLTQ 1077 QPGPRDSLLQC+IKRNR+ TYYLYLGL Q Sbjct: 116 QPGPRDSLLQCYIKRNRSNQTYYLYLGLNQ 145 >ref|XP_007050786.1| Tubby like protein 3 isoform 1 [Theobroma cacao] gi|590718314|ref|XP_007050788.1| Tubby like protein 3 isoform 1 [Theobroma cacao] gi|508703047|gb|EOX94943.1| Tubby like protein 3 isoform 1 [Theobroma cacao] gi|508703049|gb|EOX94945.1| Tubby like protein 3 isoform 1 [Theobroma cacao] Length = 405 Score = 58.5 bits (140), Expect = 5e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 988 QPGPRDSLLQCFIKRNRNTHTYYLYLGLTQ 1077 QPGPRDSLLQC+IKRNR+ TYYLYLGL Q Sbjct: 116 QPGPRDSLLQCYIKRNRSNQTYYLYLGLNQ 145