BLASTX nr result
ID: Akebia26_contig00013846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00013846 (375 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006467511.1| PREDICTED: chlorophyll a-b binding protein 3... 63 4e-08 gb|EXB69298.1| Chlorophyll a-b binding protein 40 [Morus notabilis] 62 8e-08 gb|EXB69297.1| Chlorophyll a-b binding protein 40 [Morus notabilis] 62 8e-08 gb|EXB44448.1| Chlorophyll a-b binding protein 16 [Morus notabilis] 62 8e-08 dbj|BAA25396.1| light harvesting chlorophyll a/b-binding protein... 62 8e-08 dbj|BAA00536.1| type I light-harvesting chlorophyll a/b-binding ... 62 8e-08 sp|P27493.1|CB22_TOBAC RecName: Full=Chlorophyll a-b binding pro... 62 8e-08 dbj|BAA25393.1| light harvesting chlorophyll a/b-binding protein... 62 8e-08 emb|CAA48410.1| light harvesting chlorophyll a /b binding protei... 62 8e-08 dbj|BAA25392.1| light harvesting chlorophyll a/b-binding protein... 62 8e-08 dbj|BAA25391.1| light harvesting chlorophyll a/b-binding protein... 62 8e-08 ref|XP_006660556.1| PREDICTED: chlorophyll a-b binding protein 2... 62 8e-08 ref|XP_006646072.1| PREDICTED: chlorophyll a-b binding protein 2... 62 8e-08 ref|XP_006587015.1| PREDICTED: chlorophyll a-b binding protein o... 62 8e-08 ref|XP_006467509.1| PREDICTED: chlorophyll a-b binding protein 3... 62 8e-08 ref|XP_007158961.1| hypothetical protein PHAVU_002G196400g [Phas... 62 8e-08 ref|XP_007158464.1| hypothetical protein PHAVU_002G154500g [Phas... 62 8e-08 ref|XP_007151997.1| hypothetical protein PHAVU_004G093100g [Phas... 62 8e-08 ref|XP_007151996.1| hypothetical protein PHAVU_004G093000g [Phas... 62 8e-08 ref|XP_007151995.1| hypothetical protein PHAVU_004G0929000g, par... 62 8e-08 >ref|XP_006467511.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like [Citrus sinensis] Length = 399 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/40 (80%), Positives = 33/40 (82%), Gaps = 2/40 (5%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK*EGG--IFSKSKL 261 LENLADHLADPVNNNAWAYATNFVPGK G IFS+ L Sbjct: 238 LENLADHLADPVNNNAWAYATNFVPGKKFAGAQIFSEGGL 277 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK 294 LENLADHLADPVNNNAWAYATNFVPGK Sbjct: 373 LENLADHLADPVNNNAWAYATNFVPGK 399 >gb|EXB69298.1| Chlorophyll a-b binding protein 40 [Morus notabilis] Length = 265 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK 294 LENLADHLADPVNNNAWAYATNFVPGK Sbjct: 239 LENLADHLADPVNNNAWAYATNFVPGK 265 >gb|EXB69297.1| Chlorophyll a-b binding protein 40 [Morus notabilis] Length = 265 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK 294 LENLADHLADPVNNNAWAYATNFVPGK Sbjct: 239 LENLADHLADPVNNNAWAYATNFVPGK 265 >gb|EXB44448.1| Chlorophyll a-b binding protein 16 [Morus notabilis] Length = 261 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK 294 LENLADHLADPVNNNAWAYATNFVPGK Sbjct: 235 LENLADHLADPVNNNAWAYATNFVPGK 261 >dbj|BAA25396.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 267 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK 294 LENLADHLADPVNNNAWAYATNFVPGK Sbjct: 241 LENLADHLADPVNNNAWAYATNFVPGK 267 >dbj|BAA00536.1| type I light-harvesting chlorophyll a/b-binding protein [Oryza sativa Japonica Group] gi|227611|prf||1707316A chlorophyll a/b binding protein 1 Length = 265 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK 294 LENLADHLADPVNNNAWAYATNFVPGK Sbjct: 239 LENLADHLADPVNNNAWAYATNFVPGK 265 >sp|P27493.1|CB22_TOBAC RecName: Full=Chlorophyll a-b binding protein 21, chloroplastic; AltName: Full=LHCII type I CAB-21; Short=LHCP; Flags: Precursor gi|19823|emb|CAA36957.1| unnamed protein product [Nicotiana tabacum] Length = 265 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK 294 LENLADHLADPVNNNAWAYATNFVPGK Sbjct: 239 LENLADHLADPVNNNAWAYATNFVPGK 265 >dbj|BAA25393.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 266 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK 294 LENLADHLADPVNNNAWAYATNFVPGK Sbjct: 240 LENLADHLADPVNNNAWAYATNFVPGK 266 >emb|CAA48410.1| light harvesting chlorophyll a /b binding protein [Hedera helix] Length = 193 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK 294 LENLADHLADPVNNNAWAYATNFVPGK Sbjct: 167 LENLADHLADPVNNNAWAYATNFVPGK 193 >dbj|BAA25392.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 267 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK 294 LENLADHLADPVNNNAWAYATNFVPGK Sbjct: 241 LENLADHLADPVNNNAWAYATNFVPGK 267 >dbj|BAA25391.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 265 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK 294 LENLADHLADPVNNNAWAYATNFVPGK Sbjct: 239 LENLADHLADPVNNNAWAYATNFVPGK 265 >ref|XP_006660556.1| PREDICTED: chlorophyll a-b binding protein 2, chloroplastic-like [Oryza brachyantha] Length = 263 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK 294 LENLADHLADPVNNNAWAYATNFVPGK Sbjct: 237 LENLADHLADPVNNNAWAYATNFVPGK 263 >ref|XP_006646072.1| PREDICTED: chlorophyll a-b binding protein 2, chloroplastic-like [Oryza brachyantha] Length = 237 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK 294 LENLADHLADPVNNNAWAYATNFVPGK Sbjct: 211 LENLADHLADPVNNNAWAYATNFVPGK 237 >ref|XP_006587015.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Glycine max] Length = 98 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK 294 LENLADHLADPVNNNAWAYATNFVPGK Sbjct: 72 LENLADHLADPVNNNAWAYATNFVPGK 98 >ref|XP_006467509.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like [Citrus sinensis] Length = 264 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK 294 LENLADHLADPVNNNAWAYATNFVPGK Sbjct: 238 LENLADHLADPVNNNAWAYATNFVPGK 264 >ref|XP_007158961.1| hypothetical protein PHAVU_002G196400g [Phaseolus vulgaris] gi|561032376|gb|ESW30955.1| hypothetical protein PHAVU_002G196400g [Phaseolus vulgaris] Length = 263 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK 294 LENLADHLADPVNNNAWAYATNFVPGK Sbjct: 237 LENLADHLADPVNNNAWAYATNFVPGK 263 >ref|XP_007158464.1| hypothetical protein PHAVU_002G154500g [Phaseolus vulgaris] gi|593790854|ref|XP_007158466.1| hypothetical protein PHAVU_002G154700g [Phaseolus vulgaris] gi|561031879|gb|ESW30458.1| hypothetical protein PHAVU_002G154500g [Phaseolus vulgaris] gi|561031881|gb|ESW30460.1| hypothetical protein PHAVU_002G154700g [Phaseolus vulgaris] Length = 264 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK 294 LENLADHLADPVNNNAWAYATNFVPGK Sbjct: 238 LENLADHLADPVNNNAWAYATNFVPGK 264 >ref|XP_007151997.1| hypothetical protein PHAVU_004G093100g [Phaseolus vulgaris] gi|561025306|gb|ESW23991.1| hypothetical protein PHAVU_004G093100g [Phaseolus vulgaris] Length = 160 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK 294 LENLADHLADPVNNNAWAYATNFVPGK Sbjct: 134 LENLADHLADPVNNNAWAYATNFVPGK 160 >ref|XP_007151996.1| hypothetical protein PHAVU_004G093000g [Phaseolus vulgaris] gi|561025305|gb|ESW23990.1| hypothetical protein PHAVU_004G093000g [Phaseolus vulgaris] Length = 264 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK 294 LENLADHLADPVNNNAWAYATNFVPGK Sbjct: 238 LENLADHLADPVNNNAWAYATNFVPGK 264 >ref|XP_007151995.1| hypothetical protein PHAVU_004G0929000g, partial [Phaseolus vulgaris] gi|561025304|gb|ESW23989.1| hypothetical protein PHAVU_004G0929000g, partial [Phaseolus vulgaris] Length = 93 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 374 LENLADHLADPVNNNAWAYATNFVPGK 294 LENLADHLADPVNNNAWAYATNFVPGK Sbjct: 67 LENLADHLADPVNNNAWAYATNFVPGK 93