BLASTX nr result
ID: Akebia26_contig00013699
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00013699 (1154 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006343979.1| PREDICTED: kinesin-4-like [Solanum tuberosum] 70 1e-09 ref|XP_004245601.1| PREDICTED: kinesin-3-like [Solanum lycopersi... 70 1e-09 gb|AAC24096.1| Strong similarity to kinesin homolog IG002P16.12 ... 70 1e-09 gb|EYU23471.1| hypothetical protein MIMGU_mgv1a000947mg [Mimulus... 70 2e-09 ref|XP_006857693.1| hypothetical protein AMTR_s00061p00165490 [A... 70 2e-09 ref|XP_002298032.2| kinesin motor family protein [Populus tricho... 70 2e-09 ref|XP_002278468.2| PREDICTED: kinesin-4-like [Vitis vinifera] 69 3e-09 ref|XP_002269237.2| PREDICTED: kinesin-4-like [Vitis vinifera] 69 3e-09 emb|CBI39561.3| unnamed protein product [Vitis vinifera] 69 3e-09 emb|CBI36904.3| unnamed protein product [Vitis vinifera] 69 3e-09 emb|CAN83787.1| hypothetical protein VITISV_024511 [Vitis vinifera] 69 3e-09 emb|CAN74504.1| hypothetical protein VITISV_015888 [Vitis vinifera] 69 3e-09 gb|EYU46766.1| hypothetical protein MIMGU_mgv1a000861mg [Mimulus... 69 4e-09 ref|XP_007160066.1| hypothetical protein PHAVU_002G289700g [Phas... 69 4e-09 ref|XP_007040244.1| P-loop nucleoside triphosphate hydrolases su... 69 4e-09 ref|XP_007040243.1| P-loop nucleoside triphosphate hydrolases su... 69 4e-09 ref|XP_007040242.1| P-loop nucleoside triphosphate hydrolases su... 69 4e-09 ref|XP_007210907.1| hypothetical protein PRUPE_ppa000796mg [Prun... 69 4e-09 emb|CBI34668.3| unnamed protein product [Vitis vinifera] 69 4e-09 ref|XP_002274169.1| PREDICTED: uncharacterized protein LOC100256... 69 4e-09 >ref|XP_006343979.1| PREDICTED: kinesin-4-like [Solanum tuberosum] Length = 920 Score = 70.5 bits (171), Expect = 1e-09 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = -1 Query: 119 AIYDEEVFADTQPLICFVLDGYNVCIFAYGQTGSGKTYT 3 A+ EEVF DTQPLI VLDGYNVCIFAYGQTGSGKTYT Sbjct: 387 AVTQEEVFRDTQPLIRSVLDGYNVCIFAYGQTGSGKTYT 425 >ref|XP_004245601.1| PREDICTED: kinesin-3-like [Solanum lycopersicum] Length = 921 Score = 70.5 bits (171), Expect = 1e-09 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = -1 Query: 119 AIYDEEVFADTQPLICFVLDGYNVCIFAYGQTGSGKTYT 3 A+ EEVF DTQPLI VLDGYNVCIFAYGQTGSGKTYT Sbjct: 387 AVTQEEVFRDTQPLIRSVLDGYNVCIFAYGQTGSGKTYT 425 >gb|AAC24096.1| Strong similarity to kinesin homolog IG002P16.12 gb|2191180 from A. thaliana BAC gb|AF007270 [Arabidopsis thaliana] Length = 1032 Score = 70.5 bits (171), Expect = 1e-09 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -1 Query: 122 NAIYDEEVFADTQPLICFVLDGYNVCIFAYGQTGSGKTYT 3 N +Y E VFADTQPLI VLDGYNVCIFAYGQTGSGKT+T Sbjct: 509 NFLYVEAVFADTQPLIRSVLDGYNVCIFAYGQTGSGKTFT 548 >gb|EYU23471.1| hypothetical protein MIMGU_mgv1a000947mg [Mimulus guttatus] Length = 936 Score = 70.1 bits (170), Expect = 2e-09 Identities = 33/45 (73%), Positives = 36/45 (80%) Frame = -1 Query: 137 NYFHENAIYDEEVFADTQPLICFVLDGYNVCIFAYGQTGSGKTYT 3 N + A+ E+VF DTQPLI VLDGYNVCIFAYGQTGSGKTYT Sbjct: 391 NKVFDPAVTQEDVFRDTQPLIRSVLDGYNVCIFAYGQTGSGKTYT 435 >ref|XP_006857693.1| hypothetical protein AMTR_s00061p00165490 [Amborella trichopoda] gi|548861789|gb|ERN19160.1| hypothetical protein AMTR_s00061p00165490 [Amborella trichopoda] Length = 1139 Score = 70.1 bits (170), Expect = 2e-09 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -1 Query: 131 FHENAIYDEEVFADTQPLICFVLDGYNVCIFAYGQTGSGKTYT 3 F NA+ D+ VFADTQPLI VLDGYNVCIFAYGQTGSGKTYT Sbjct: 494 FGTNAMQDQ-VFADTQPLIRSVLDGYNVCIFAYGQTGSGKTYT 535 >ref|XP_002298032.2| kinesin motor family protein [Populus trichocarpa] gi|550346887|gb|EEE82837.2| kinesin motor family protein [Populus trichocarpa] Length = 1018 Score = 69.7 bits (169), Expect = 2e-09 Identities = 35/46 (76%), Positives = 35/46 (76%) Frame = -1 Query: 140 LNYFHENAIYDEEVFADTQPLICFVLDGYNVCIFAYGQTGSGKTYT 3 LN A EEVF DTQPLI VLDGYNVCIFAYGQTGSGKTYT Sbjct: 505 LNKVFGPAATQEEVFLDTQPLIRSVLDGYNVCIFAYGQTGSGKTYT 550 >ref|XP_002278468.2| PREDICTED: kinesin-4-like [Vitis vinifera] Length = 1056 Score = 69.3 bits (168), Expect = 3e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 107 EEVFADTQPLICFVLDGYNVCIFAYGQTGSGKTYT 3 EEVF+DTQPLI VLDGYNVCIFAYGQTGSGKTYT Sbjct: 482 EEVFSDTQPLIRSVLDGYNVCIFAYGQTGSGKTYT 516 >ref|XP_002269237.2| PREDICTED: kinesin-4-like [Vitis vinifera] Length = 1011 Score = 69.3 bits (168), Expect = 3e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 107 EEVFADTQPLICFVLDGYNVCIFAYGQTGSGKTYT 3 EEVF+DTQPLI VLDGYNVCIFAYGQTGSGKTYT Sbjct: 457 EEVFSDTQPLIRSVLDGYNVCIFAYGQTGSGKTYT 491 >emb|CBI39561.3| unnamed protein product [Vitis vinifera] Length = 1044 Score = 69.3 bits (168), Expect = 3e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 107 EEVFADTQPLICFVLDGYNVCIFAYGQTGSGKTYT 3 EEVF+DTQPLI VLDGYNVCIFAYGQTGSGKTYT Sbjct: 469 EEVFSDTQPLIRSVLDGYNVCIFAYGQTGSGKTYT 503 >emb|CBI36904.3| unnamed protein product [Vitis vinifera] Length = 1017 Score = 69.3 bits (168), Expect = 3e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 107 EEVFADTQPLICFVLDGYNVCIFAYGQTGSGKTYT 3 EEVF+DTQPLI VLDGYNVCIFAYGQTGSGKTYT Sbjct: 457 EEVFSDTQPLIRSVLDGYNVCIFAYGQTGSGKTYT 491 >emb|CAN83787.1| hypothetical protein VITISV_024511 [Vitis vinifera] Length = 1172 Score = 69.3 bits (168), Expect = 3e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 107 EEVFADTQPLICFVLDGYNVCIFAYGQTGSGKTYT 3 EEVF+DTQPLI VLDGYNVCIFAYGQTGSGKTYT Sbjct: 474 EEVFSDTQPLIRSVLDGYNVCIFAYGQTGSGKTYT 508 >emb|CAN74504.1| hypothetical protein VITISV_015888 [Vitis vinifera] Length = 1058 Score = 69.3 bits (168), Expect = 3e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 107 EEVFADTQPLICFVLDGYNVCIFAYGQTGSGKTYT 3 EEVF+DTQPLI VLDGYNVCIFAYGQTGSGKTYT Sbjct: 482 EEVFSDTQPLIRSVLDGYNVCIFAYGQTGSGKTYT 516 >gb|EYU46766.1| hypothetical protein MIMGU_mgv1a000861mg [Mimulus guttatus] Length = 957 Score = 68.9 bits (167), Expect = 4e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 107 EEVFADTQPLICFVLDGYNVCIFAYGQTGSGKTYT 3 EEVF+DTQPL+ VLDGYNVCIFAYGQTGSGKTYT Sbjct: 457 EEVFSDTQPLVRSVLDGYNVCIFAYGQTGSGKTYT 491 >ref|XP_007160066.1| hypothetical protein PHAVU_002G289700g [Phaseolus vulgaris] gi|593794057|ref|XP_007160067.1| hypothetical protein PHAVU_002G289700g [Phaseolus vulgaris] gi|561033481|gb|ESW32060.1| hypothetical protein PHAVU_002G289700g [Phaseolus vulgaris] gi|561033482|gb|ESW32061.1| hypothetical protein PHAVU_002G289700g [Phaseolus vulgaris] Length = 1080 Score = 68.9 bits (167), Expect = 4e-09 Identities = 33/39 (84%), Positives = 33/39 (84%) Frame = -1 Query: 119 AIYDEEVFADTQPLICFVLDGYNVCIFAYGQTGSGKTYT 3 A EEVF DTQPLI VLDGYNVCIFAYGQTGSGKTYT Sbjct: 546 ATSQEEVFKDTQPLIRSVLDGYNVCIFAYGQTGSGKTYT 584 >ref|XP_007040244.1| P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin ) domain, putative isoform 3 [Theobroma cacao] gi|508777489|gb|EOY24745.1| P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin ) domain, putative isoform 3 [Theobroma cacao] Length = 969 Score = 68.9 bits (167), Expect = 4e-09 Identities = 33/39 (84%), Positives = 33/39 (84%) Frame = -1 Query: 119 AIYDEEVFADTQPLICFVLDGYNVCIFAYGQTGSGKTYT 3 A EEVF DTQPLI VLDGYNVCIFAYGQTGSGKTYT Sbjct: 433 AATQEEVFLDTQPLIRSVLDGYNVCIFAYGQTGSGKTYT 471 >ref|XP_007040243.1| P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin ) domain, putative isoform 2 [Theobroma cacao] gi|508777488|gb|EOY24744.1| P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin ) domain, putative isoform 2 [Theobroma cacao] Length = 1044 Score = 68.9 bits (167), Expect = 4e-09 Identities = 33/39 (84%), Positives = 33/39 (84%) Frame = -1 Query: 119 AIYDEEVFADTQPLICFVLDGYNVCIFAYGQTGSGKTYT 3 A EEVF DTQPLI VLDGYNVCIFAYGQTGSGKTYT Sbjct: 508 AATQEEVFLDTQPLIRSVLDGYNVCIFAYGQTGSGKTYT 546 >ref|XP_007040242.1| P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin ) domain, putative isoform 1 [Theobroma cacao] gi|508777487|gb|EOY24743.1| P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin ) domain, putative isoform 1 [Theobroma cacao] Length = 1061 Score = 68.9 bits (167), Expect = 4e-09 Identities = 33/39 (84%), Positives = 33/39 (84%) Frame = -1 Query: 119 AIYDEEVFADTQPLICFVLDGYNVCIFAYGQTGSGKTYT 3 A EEVF DTQPLI VLDGYNVCIFAYGQTGSGKTYT Sbjct: 508 AATQEEVFLDTQPLIRSVLDGYNVCIFAYGQTGSGKTYT 546 >ref|XP_007210907.1| hypothetical protein PRUPE_ppa000796mg [Prunus persica] gi|462406642|gb|EMJ12106.1| hypothetical protein PRUPE_ppa000796mg [Prunus persica] Length = 1000 Score = 68.9 bits (167), Expect = 4e-09 Identities = 33/39 (84%), Positives = 33/39 (84%) Frame = -1 Query: 119 AIYDEEVFADTQPLICFVLDGYNVCIFAYGQTGSGKTYT 3 A EEVF DTQPLI VLDGYNVCIFAYGQTGSGKTYT Sbjct: 483 AATQEEVFLDTQPLIRSVLDGYNVCIFAYGQTGSGKTYT 521 >emb|CBI34668.3| unnamed protein product [Vitis vinifera] Length = 1071 Score = 68.9 bits (167), Expect = 4e-09 Identities = 33/39 (84%), Positives = 33/39 (84%) Frame = -1 Query: 119 AIYDEEVFADTQPLICFVLDGYNVCIFAYGQTGSGKTYT 3 A EEVF DTQPLI VLDGYNVCIFAYGQTGSGKTYT Sbjct: 578 AATQEEVFLDTQPLIRSVLDGYNVCIFAYGQTGSGKTYT 616 >ref|XP_002274169.1| PREDICTED: uncharacterized protein LOC100256435 [Vitis vinifera] Length = 1101 Score = 68.9 bits (167), Expect = 4e-09 Identities = 33/39 (84%), Positives = 33/39 (84%) Frame = -1 Query: 119 AIYDEEVFADTQPLICFVLDGYNVCIFAYGQTGSGKTYT 3 A EEVF DTQPLI VLDGYNVCIFAYGQTGSGKTYT Sbjct: 578 AATQEEVFLDTQPLIRSVLDGYNVCIFAYGQTGSGKTYT 616