BLASTX nr result
ID: Akebia26_contig00013687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00013687 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278791.1| PREDICTED: Down syndrome critical region pro... 98 1e-18 emb|CBI15584.3| unnamed protein product [Vitis vinifera] 98 1e-18 ref|XP_007152671.1| hypothetical protein PHAVU_004G149400g [Phas... 98 1e-18 ref|XP_006587470.1| PREDICTED: Down syndrome critical region pro... 97 3e-18 ref|XP_003534139.1| PREDICTED: Down syndrome critical region pro... 97 3e-18 ref|XP_007036810.1| Vacuolar protein sorting-associated protein ... 96 4e-18 ref|XP_007036809.1| Vacuolar protein sorting-associated protein ... 96 4e-18 ref|XP_007152682.1| hypothetical protein PHAVU_004G150300g [Phas... 96 5e-18 ref|XP_002530476.1| down syndrome critical region protein, putat... 96 7e-18 ref|XP_006374197.1| hypothetical protein POPTR_0015s04670g [Popu... 94 2e-17 ref|XP_002321517.1| vacuolar protein sorting-associated protein ... 94 2e-17 ref|XP_006490786.1| PREDICTED: Down syndrome critical region pro... 93 4e-17 ref|XP_006583459.1| PREDICTED: Down syndrome critical region pro... 89 5e-16 ref|XP_006451603.1| hypothetical protein CICLE_v10010588mg [Citr... 89 5e-16 ref|XP_004161832.1| PREDICTED: Down syndrome critical region pro... 89 5e-16 ref|XP_004137506.1| PREDICTED: Down syndrome critical region pro... 89 5e-16 ref|XP_007209486.1| hypothetical protein PRUPE_ppa010156mg [Prun... 89 6e-16 ref|XP_004299523.1| PREDICTED: Down syndrome critical region pro... 87 2e-15 gb|ACU20142.1| unknown [Glycine max] 87 2e-15 ref|XP_004512747.1| PREDICTED: Down syndrome critical region pro... 86 5e-15 >ref|XP_002278791.1| PREDICTED: Down syndrome critical region protein 3 homolog [Vitis vinifera] Length = 314 Score = 98.2 bits (243), Expect = 1e-18 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -2 Query: 330 CPTVLAGPFSIEFQVSIVICFQSKLSKLHPKSDPKTPRLWLAMETLPLSLFRTK 169 CPTVLAGPFSIEF++SIVI F+S+L KLHPKSDPKTPRLWLAMET+PL L RTK Sbjct: 261 CPTVLAGPFSIEFKISIVITFESELVKLHPKSDPKTPRLWLAMETIPLELIRTK 314 >emb|CBI15584.3| unnamed protein product [Vitis vinifera] Length = 314 Score = 98.2 bits (243), Expect = 1e-18 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -2 Query: 330 CPTVLAGPFSIEFQVSIVICFQSKLSKLHPKSDPKTPRLWLAMETLPLSLFRTK 169 CPTVLAGPFSIEF++SIVI F+S+L KLHPKSDPKTPRLWLAMET+PL L RTK Sbjct: 261 CPTVLAGPFSIEFKISIVITFESELVKLHPKSDPKTPRLWLAMETIPLELIRTK 314 >ref|XP_007152671.1| hypothetical protein PHAVU_004G149400g [Phaseolus vulgaris] gi|561025980|gb|ESW24665.1| hypothetical protein PHAVU_004G149400g [Phaseolus vulgaris] Length = 316 Score = 97.8 bits (242), Expect = 1e-18 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -2 Query: 330 CPTVLAGPFSIEFQVSIVICFQSKLSKLHPKSDPKTPRLWLAMETLPLSLFRTK 169 CPT+LAGPFSIEF+V+IVI FQS+LSKLH KSDPKTPRLWLAMETLPL L RTK Sbjct: 263 CPTILAGPFSIEFKVAIVISFQSELSKLHKKSDPKTPRLWLAMETLPLELVRTK 316 >ref|XP_006587470.1| PREDICTED: Down syndrome critical region protein 3 homolog isoform X2 [Glycine max] Length = 310 Score = 96.7 bits (239), Expect = 3e-18 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = -2 Query: 330 CPTVLAGPFSIEFQVSIVICFQSKLSKLHPKSDPKTPRLWLAMETLPLSLFRTK 169 CPT LAGPFS+EF+V+IVI FQS+LSKLH KSDPKTPRLWLAMETLPL L RTK Sbjct: 257 CPTTLAGPFSVEFKVAIVISFQSELSKLHKKSDPKTPRLWLAMETLPLELIRTK 310 >ref|XP_003534139.1| PREDICTED: Down syndrome critical region protein 3 homolog isoform X1 [Glycine max] Length = 316 Score = 96.7 bits (239), Expect = 3e-18 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = -2 Query: 330 CPTVLAGPFSIEFQVSIVICFQSKLSKLHPKSDPKTPRLWLAMETLPLSLFRTK 169 CPT LAGPFS+EF+V+IVI FQS+LSKLH KSDPKTPRLWLAMETLPL L RTK Sbjct: 263 CPTTLAGPFSVEFKVAIVISFQSELSKLHKKSDPKTPRLWLAMETLPLELIRTK 316 >ref|XP_007036810.1| Vacuolar protein sorting-associated protein 26 isoform 2 [Theobroma cacao] gi|508774055|gb|EOY21311.1| Vacuolar protein sorting-associated protein 26 isoform 2 [Theobroma cacao] Length = 324 Score = 96.3 bits (238), Expect = 4e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -2 Query: 330 CPTVLAGPFSIEFQVSIVICFQSKLSKLHPKSDPKTPRLWLAMETLPLSLFRT 172 CPTVLAGPFSIEF+V+IVI FQS+LSKLHPKSDP+TPRLW AMETLPL L RT Sbjct: 266 CPTVLAGPFSIEFKVAIVISFQSELSKLHPKSDPRTPRLWTAMETLPLELVRT 318 >ref|XP_007036809.1| Vacuolar protein sorting-associated protein 26 isoform 1 [Theobroma cacao] gi|508774054|gb|EOY21310.1| Vacuolar protein sorting-associated protein 26 isoform 1 [Theobroma cacao] Length = 368 Score = 96.3 bits (238), Expect = 4e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -2 Query: 330 CPTVLAGPFSIEFQVSIVICFQSKLSKLHPKSDPKTPRLWLAMETLPLSLFRT 172 CPTVLAGPFSIEF+V+IVI FQS+LSKLHPKSDP+TPRLW AMETLPL L RT Sbjct: 307 CPTVLAGPFSIEFKVAIVISFQSELSKLHPKSDPRTPRLWTAMETLPLELVRT 359 >ref|XP_007152682.1| hypothetical protein PHAVU_004G150300g [Phaseolus vulgaris] gi|561025991|gb|ESW24676.1| hypothetical protein PHAVU_004G150300g [Phaseolus vulgaris] Length = 316 Score = 95.9 bits (237), Expect = 5e-18 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = -2 Query: 330 CPTVLAGPFSIEFQVSIVICFQSKLSKLHPKSDPKTPRLWLAMETLPLSLFRTK 169 CPT+LAGPFSIEF+V+IVI FQS+LSKLH KSDPKTPRLWLAMETLPL L R K Sbjct: 263 CPTILAGPFSIEFKVAIVISFQSELSKLHKKSDPKTPRLWLAMETLPLELVRAK 316 >ref|XP_002530476.1| down syndrome critical region protein, putative [Ricinus communis] gi|223529973|gb|EEF31899.1| down syndrome critical region protein, putative [Ricinus communis] Length = 272 Score = 95.5 bits (236), Expect = 7e-18 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -2 Query: 330 CPTVLAGPFSIEFQVSIVICFQSKLSKLHPKSDPKTPRLWLAMETLPLSLFRTK 169 CPTVLAGPFSIEF+VSIVI FQS+LS+LH KSDP+TPRLWLAMETLPL L R+K Sbjct: 219 CPTVLAGPFSIEFKVSIVISFQSELSRLHTKSDPRTPRLWLAMETLPLELVRSK 272 >ref|XP_006374197.1| hypothetical protein POPTR_0015s04670g [Populus trichocarpa] gi|550321939|gb|ERP51994.1| hypothetical protein POPTR_0015s04670g [Populus trichocarpa] Length = 320 Score = 94.0 bits (232), Expect = 2e-17 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = -2 Query: 330 CPTVLAGPFSIEFQVSIVICFQSKLSKLHPKSDPKTPRLWLAMETLPLSLFRTK 169 CP+V AGPFSIEF+VSIVI FQS+LSKLH KSDP+TPRLWLAMETLPL L RT+ Sbjct: 267 CPSVFAGPFSIEFKVSIVISFQSELSKLHKKSDPRTPRLWLAMETLPLELVRTR 320 >ref|XP_002321517.1| vacuolar protein sorting-associated protein 26 [Populus trichocarpa] gi|222868513|gb|EEF05644.1| vacuolar protein sorting-associated protein 26 [Populus trichocarpa] Length = 319 Score = 94.0 bits (232), Expect = 2e-17 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = -2 Query: 330 CPTVLAGPFSIEFQVSIVICFQSKLSKLHPKSDPKTPRLWLAMETLPLSLFRTK 169 CP+V AGPFSIEF+VSIVI FQS+LSKLH KSDP+TPRLWLAMETLPL L RT+ Sbjct: 266 CPSVFAGPFSIEFKVSIVISFQSELSKLHKKSDPRTPRLWLAMETLPLELVRTR 319 >ref|XP_006490786.1| PREDICTED: Down syndrome critical region protein 3 homolog [Citrus sinensis] Length = 318 Score = 92.8 bits (229), Expect = 4e-17 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -2 Query: 330 CPTVLAGPFSIEFQVSIVICFQSKLSKLHPKSDPKTPRLWLAMETLPLSLFRT 172 CPTVLAGPFS+EF+VS+VI F+S+LSKLH KSDP TPRLWLAMETLPL L RT Sbjct: 265 CPTVLAGPFSVEFKVSVVISFRSELSKLHKKSDPTTPRLWLAMETLPLELVRT 317 >ref|XP_006583459.1| PREDICTED: Down syndrome critical region protein 3 homolog [Glycine max] Length = 319 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/54 (79%), Positives = 47/54 (87%) Frame = -2 Query: 330 CPTVLAGPFSIEFQVSIVICFQSKLSKLHPKSDPKTPRLWLAMETLPLSLFRTK 169 CPT LAGPFS+EF+V+IVI FQS+LSKLH KSD KTPRLWLAMETL L L RTK Sbjct: 266 CPTTLAGPFSVEFKVAIVISFQSELSKLHKKSDAKTPRLWLAMETLLLELVRTK 319 >ref|XP_006451603.1| hypothetical protein CICLE_v10010588mg [Citrus clementina] gi|557554829|gb|ESR64843.1| hypothetical protein CICLE_v10010588mg [Citrus clementina] Length = 295 Score = 89.4 bits (220), Expect = 5e-16 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -2 Query: 330 CPTVLAGPFSIEFQVSIVICFQSKLSKLHPKSDPKTPRLWLAMETLPLSL 181 CPTVLAGPFS+EF+VS+VI F+S+LSKLH KSDP TPRLWLAMETLPL L Sbjct: 235 CPTVLAGPFSVEFKVSVVISFRSELSKLHKKSDPTTPRLWLAMETLPLEL 284 >ref|XP_004161832.1| PREDICTED: Down syndrome critical region protein 3-like [Cucumis sativus] Length = 320 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/54 (74%), Positives = 48/54 (88%) Frame = -2 Query: 330 CPTVLAGPFSIEFQVSIVICFQSKLSKLHPKSDPKTPRLWLAMETLPLSLFRTK 169 CPTV AGPFSIEF+V IVI FQS+LSKLHPK+DP+TPRLWLA+E+LP+ L R + Sbjct: 264 CPTVFAGPFSIEFKVYIVITFQSELSKLHPKTDPRTPRLWLAIESLPMELLRCR 317 >ref|XP_004137506.1| PREDICTED: Down syndrome critical region protein 3-like [Cucumis sativus] Length = 320 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/54 (74%), Positives = 48/54 (88%) Frame = -2 Query: 330 CPTVLAGPFSIEFQVSIVICFQSKLSKLHPKSDPKTPRLWLAMETLPLSLFRTK 169 CPTV AGPFSIEF+V IVI FQS+LSKLHPK+DP+TPRLWLA+E+LP+ L R + Sbjct: 264 CPTVFAGPFSIEFKVYIVITFQSELSKLHPKTDPRTPRLWLAIESLPMELLRCR 317 >ref|XP_007209486.1| hypothetical protein PRUPE_ppa010156mg [Prunus persica] gi|462405221|gb|EMJ10685.1| hypothetical protein PRUPE_ppa010156mg [Prunus persica] Length = 261 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -2 Query: 330 CPTVLAGPFSIEFQVSIVICFQSKLSKLHPKSDPKTPRLWLAMETLPLSLFRTK 169 CPTVLAGPFSIEF+V+IVI FQS ++K+H KSDP TPRLWLAME+LPL L RT+ Sbjct: 208 CPTVLAGPFSIEFKVAIVITFQSDVAKVHSKSDPTTPRLWLAMESLPLELVRTR 261 >ref|XP_004299523.1| PREDICTED: Down syndrome critical region protein 3 homolog [Fragaria vesca subsp. vesca] Length = 317 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/54 (75%), Positives = 47/54 (87%) Frame = -2 Query: 330 CPTVLAGPFSIEFQVSIVICFQSKLSKLHPKSDPKTPRLWLAMETLPLSLFRTK 169 CPTV AGPFSIEF+V IVI FQS+++KLH KSDP TPRLWLAME+LPL L RT+ Sbjct: 264 CPTVSAGPFSIEFKVVIVITFQSEVAKLHSKSDPTTPRLWLAMESLPLELVRTR 317 >gb|ACU20142.1| unknown [Glycine max] Length = 183 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/54 (77%), Positives = 46/54 (85%) Frame = -2 Query: 330 CPTVLAGPFSIEFQVSIVICFQSKLSKLHPKSDPKTPRLWLAMETLPLSLFRTK 169 CPT LAGPFS+EF+V+IVI FQS+LSKLH KSD KTPRLWLAMET L L RTK Sbjct: 130 CPTTLAGPFSVEFKVAIVISFQSELSKLHKKSDAKTPRLWLAMETSLLELVRTK 183 >ref|XP_004512747.1| PREDICTED: Down syndrome critical region protein 3 homolog isoform X2 [Cicer arietinum] Length = 312 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/52 (76%), Positives = 45/52 (86%) Frame = -2 Query: 330 CPTVLAGPFSIEFQVSIVICFQSKLSKLHPKSDPKTPRLWLAMETLPLSLFR 175 CPT+ AGPFSIEF+V+IVI FQS+LSKLH KSD +TPRLWLA ETLPL L R Sbjct: 259 CPTIFAGPFSIEFKVAIVISFQSELSKLHKKSDSRTPRLWLATETLPLELVR 310