BLASTX nr result
ID: Akebia26_contig00013613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00013613 (677 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB46049.1| Protein BREAST CANCER SUSCEPTIBILITY 1-like prote... 60 8e-07 ref|XP_002526570.1| brca1 associated ring domain, putative [Rici... 59 1e-06 ref|XP_004163582.1| PREDICTED: protein BREAST CANCER SUSCEPTIBIL... 58 3e-06 ref|XP_004151994.1| PREDICTED: protein BREAST CANCER SUSCEPTIBIL... 58 3e-06 ref|XP_007050205.1| Breast cancer associated RING 1, putative is... 57 7e-06 ref|XP_007050203.1| Breast cancer associated RING 1, putative is... 57 7e-06 ref|XP_007050201.1| Brca1 associated ring domain, putative isofo... 57 7e-06 >gb|EXB46049.1| Protein BREAST CANCER SUSCEPTIBILITY 1-like protein [Morus notabilis] Length = 685 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +1 Query: 544 GLKGFRSDCPICKSSYVNRDLRSAPHMENMVSIYKSMDATFS 669 G F +DCP+CK+ +VN DLR+ P MENM++IYK +DATFS Sbjct: 31 GANQFGADCPVCKAHFVNIDLRNLPFMENMLTIYKCLDATFS 72 >ref|XP_002526570.1| brca1 associated ring domain, putative [Ricinus communis] gi|223534131|gb|EEF35848.1| brca1 associated ring domain, putative [Ricinus communis] Length = 744 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/51 (50%), Positives = 34/51 (66%) Frame = +1 Query: 523 CMQFMHSGLKGFRSDCPICKSSYVNRDLRSAPHMENMVSIYKSMDATFSPN 675 C +H K F S+CP+CK YV RDLR P +ENMV+IY+S+D+ F N Sbjct: 50 CNSCLHERTK-FASECPVCKDQYVGRDLRPLPFIENMVAIYRSLDSAFCAN 99 >ref|XP_004163582.1| PREDICTED: protein BREAST CANCER SUSCEPTIBILITY 1 homolog [Cucumis sativus] Length = 679 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = +1 Query: 562 SDCPICKSSYVNRDLRSAPHMENMVSIYKSMDATFSPN 675 S CP+CK+ +V+RD+R AP M+ MVSIY+S+DATFS N Sbjct: 62 SVCPLCKAGFVDRDMRPAPFMDKMVSIYRSLDATFSTN 99 >ref|XP_004151994.1| PREDICTED: protein BREAST CANCER SUSCEPTIBILITY 1 homolog [Cucumis sativus] Length = 679 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = +1 Query: 562 SDCPICKSSYVNRDLRSAPHMENMVSIYKSMDATFSPN 675 S CP+CK+ +V+RD+R AP M+ MVSIY+S+DATFS N Sbjct: 62 SVCPLCKAGFVDRDMRPAPFMDKMVSIYRSLDATFSTN 99 >ref|XP_007050205.1| Breast cancer associated RING 1, putative isoform 5, partial [Theobroma cacao] gi|508702466|gb|EOX94362.1| Breast cancer associated RING 1, putative isoform 5, partial [Theobroma cacao] Length = 473 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/40 (60%), Positives = 29/40 (72%) Frame = +1 Query: 556 FRSDCPICKSSYVNRDLRSAPHMENMVSIYKSMDATFSPN 675 F +CPICK+ Y NRDLR MEN+V IY+S+DA FS N Sbjct: 17 FGPECPICKAQYANRDLRPVTFMENIVGIYRSLDAAFSAN 56 >ref|XP_007050203.1| Breast cancer associated RING 1, putative isoform 3 [Theobroma cacao] gi|508702464|gb|EOX94360.1| Breast cancer associated RING 1, putative isoform 3 [Theobroma cacao] Length = 501 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/40 (60%), Positives = 29/40 (72%) Frame = +1 Query: 556 FRSDCPICKSSYVNRDLRSAPHMENMVSIYKSMDATFSPN 675 F +CPICK+ Y NRDLR MEN+V IY+S+DA FS N Sbjct: 59 FGPECPICKAQYANRDLRPVTFMENIVGIYRSLDAAFSAN 98 >ref|XP_007050201.1| Brca1 associated ring domain, putative isoform 1 [Theobroma cacao] gi|590715461|ref|XP_007050202.1| Brca1 associated ring domain, putative isoform 1 [Theobroma cacao] gi|508702462|gb|EOX94358.1| Brca1 associated ring domain, putative isoform 1 [Theobroma cacao] gi|508702463|gb|EOX94359.1| Brca1 associated ring domain, putative isoform 1 [Theobroma cacao] Length = 684 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/40 (60%), Positives = 29/40 (72%) Frame = +1 Query: 556 FRSDCPICKSSYVNRDLRSAPHMENMVSIYKSMDATFSPN 675 F +CPICK+ Y NRDLR MEN+V IY+S+DA FS N Sbjct: 59 FGPECPICKAQYANRDLRPVTFMENIVGIYRSLDAAFSAN 98