BLASTX nr result
ID: Akebia26_contig00009435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00009435 (287 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20070.1| hypothetical protein MIMGU_mgv1a011100mg [Mimulus... 66 4e-09 ref|XP_002311250.1| biotin/lipoyl attachment domain-containing f... 66 6e-09 ref|XP_007218764.1| hypothetical protein PRUPE_ppa009474mg [Prun... 65 7e-09 ref|XP_004240889.1| PREDICTED: biotin carboxyl carrier protein o... 65 1e-08 ref|XP_002316186.2| biotin/lipoyl attachment domain-containing f... 62 8e-08 ref|XP_002520803.1| Biotin carboxyl carrier protein of acetyl-Co... 62 8e-08 ref|XP_006353414.1| PREDICTED: biotin carboxyl carrier protein o... 62 1e-07 ref|XP_006828149.1| hypothetical protein AMTR_s00023p00073640 [A... 62 1e-07 ref|XP_007008844.1| Biotin/lipoyl attachment domain-containing p... 62 1e-07 ref|XP_002278151.2| PREDICTED: biotin carboxyl carrier protein o... 62 1e-07 ref|XP_004240890.1| PREDICTED: biotin carboxyl carrier protein o... 61 2e-07 gb|EXB25850.1| hypothetical protein L484_012276 [Morus notabilis] 60 2e-07 ref|NP_001030871.1| biotin/lipoyl attachment domain-containing p... 59 9e-07 ref|NP_974446.1| biotin/lipoyl attachment domain-containing prot... 59 9e-07 ref|NP_567035.1| biotin/lipoyl attachment domain-containing prot... 59 9e-07 ref|NP_001190101.1| biotin/lipoyl attachment domain-containing p... 59 9e-07 ref|XP_002876350.1| biotin/lipoyl attachment domain-containing p... 58 1e-06 ref|XP_006353415.1| PREDICTED: biotin carboxyl carrier protein o... 58 2e-06 ref|XP_004500525.1| PREDICTED: biotin carboxyl carrier protein o... 58 2e-06 ref|XP_006435833.1| hypothetical protein CICLE_v10032300mg [Citr... 57 2e-06 >gb|EYU20070.1| hypothetical protein MIMGU_mgv1a011100mg [Mimulus guttatus] Length = 292 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -2 Query: 286 VAGEVLKLLYNEGEAVGYGDPLVAVLPSFHGI 191 VAGEVLKLLYN+GEAVGYGDPL+AVLPSFHGI Sbjct: 260 VAGEVLKLLYNDGEAVGYGDPLIAVLPSFHGI 291 >ref|XP_002311250.1| biotin/lipoyl attachment domain-containing family protein [Populus trichocarpa] gi|222851070|gb|EEE88617.1| biotin/lipoyl attachment domain-containing family protein [Populus trichocarpa] Length = 260 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 286 VAGEVLKLLYNEGEAVGYGDPLVAVLPSFHGIN 188 VAGEVLKLL+N+G+AVGYGDPL+AVLPSFHGIN Sbjct: 227 VAGEVLKLLFNDGDAVGYGDPLIAVLPSFHGIN 259 >ref|XP_007218764.1| hypothetical protein PRUPE_ppa009474mg [Prunus persica] gi|462415226|gb|EMJ19963.1| hypothetical protein PRUPE_ppa009474mg [Prunus persica] Length = 291 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 286 VAGEVLKLLYNEGEAVGYGDPLVAVLPSFHGIN 188 V GEVLKLL+N+GEAVGYGDPL+AVLPSFHGIN Sbjct: 257 VGGEVLKLLFNDGEAVGYGDPLIAVLPSFHGIN 289 >ref|XP_004240889.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase-like isoform 1 [Solanum lycopersicum] Length = 290 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -2 Query: 283 AGEVLKLLYNEGEAVGYGDPLVAVLPSFHGIN 188 AGEVLK+L+N+GEAVGYGDPL+AVLPSFHGIN Sbjct: 259 AGEVLKILFNDGEAVGYGDPLIAVLPSFHGIN 290 >ref|XP_002316186.2| biotin/lipoyl attachment domain-containing family protein [Populus trichocarpa] gi|550330133|gb|EEF02357.2| biotin/lipoyl attachment domain-containing family protein [Populus trichocarpa] Length = 260 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 286 VAGEVLKLLYNEGEAVGYGDPLVAVLPSFHGIN 188 VAGEVLKLL+N+G+AVGYGDPLVAVLPSFH I+ Sbjct: 227 VAGEVLKLLFNDGDAVGYGDPLVAVLPSFHAID 259 >ref|XP_002520803.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase, putative [Ricinus communis] gi|223539934|gb|EEF41512.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase, putative [Ricinus communis] Length = 258 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -2 Query: 286 VAGEVLKLLYNEGEAVGYGDPLVAVLPSFHGI 191 VAGEVLKLL+++G+AVGYGDPLVAVLPSFHGI Sbjct: 226 VAGEVLKLLFDDGDAVGYGDPLVAVLPSFHGI 257 >ref|XP_006353414.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 289 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 283 AGEVLKLLYNEGEAVGYGDPLVAVLPSFHGIN 188 AGEVLK+L+N+GEAVGYGDPL+AVLPSF GIN Sbjct: 258 AGEVLKILFNDGEAVGYGDPLIAVLPSFRGIN 289 >ref|XP_006828149.1| hypothetical protein AMTR_s00023p00073640 [Amborella trichopoda] gi|548832796|gb|ERM95565.1| hypothetical protein AMTR_s00023p00073640 [Amborella trichopoda] Length = 234 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 286 VAGEVLKLLYNEGEAVGYGDPLVAVLPSFHGI 191 VAGEVLK+L+ +GEAVGYGDPL+AVLPSFHGI Sbjct: 202 VAGEVLKILFRDGEAVGYGDPLIAVLPSFHGI 233 >ref|XP_007008844.1| Biotin/lipoyl attachment domain-containing protein isoform 1 [Theobroma cacao] gi|508725757|gb|EOY17654.1| Biotin/lipoyl attachment domain-containing protein isoform 1 [Theobroma cacao] Length = 290 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -2 Query: 286 VAGEVLKLLYNEGEAVGYGDPLVAVLPSFHGI 191 VAGEVLKLL+++G+AVGYGDPL+AVLPSFHGI Sbjct: 258 VAGEVLKLLFDDGDAVGYGDPLIAVLPSFHGI 289 >ref|XP_002278151.2| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase-like [Vitis vinifera] gi|297736542|emb|CBI25413.3| unnamed protein product [Vitis vinifera] Length = 288 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -2 Query: 283 AGEVLKLLYNEGEAVGYGDPLVAVLPSFHGI 191 AGEVLK+++N+GEAVGYGDPLVAVLPSFHGI Sbjct: 257 AGEVLKVIFNDGEAVGYGDPLVAVLPSFHGI 287 >ref|XP_004240890.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase-like isoform 2 [Solanum lycopersicum] Length = 288 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -2 Query: 283 AGEVLKLLYNEGEAVGYGDPLVAVLPSFHG 194 AGEVLK+L+N+GEAVGYGDPL+AVLPSFHG Sbjct: 259 AGEVLKILFNDGEAVGYGDPLIAVLPSFHG 288 >gb|EXB25850.1| hypothetical protein L484_012276 [Morus notabilis] Length = 285 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 286 VAGEVLKLLYNEGEAVGYGDPLVAVLPSFHGI 191 + GEVLK+L+ EGEAVGYGDPL+AVLPSFHGI Sbjct: 253 IGGEVLKVLFTEGEAVGYGDPLIAVLPSFHGI 284 >ref|NP_001030871.1| biotin/lipoyl attachment domain-containing protein [Arabidopsis thaliana] gi|332645962|gb|AEE79483.1| biotin/lipoyl attachment domain-containing protein [Arabidopsis thaliana] Length = 194 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 286 VAGEVLKLLYNEGEAVGYGDPLVAVLPSFHGIN 188 VAGEVLKLL ++G++VGYGDPLVAVLPSFH IN Sbjct: 160 VAGEVLKLLSDDGDSVGYGDPLVAVLPSFHDIN 192 >ref|NP_974446.1| biotin/lipoyl attachment domain-containing protein [Arabidopsis thaliana] gi|222422895|dbj|BAH19434.1| AT3G56130 [Arabidopsis thaliana] gi|332645961|gb|AEE79482.1| biotin/lipoyl attachment domain-containing protein [Arabidopsis thaliana] Length = 205 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 286 VAGEVLKLLYNEGEAVGYGDPLVAVLPSFHGIN 188 VAGEVLKLL ++G++VGYGDPLVAVLPSFH IN Sbjct: 171 VAGEVLKLLSDDGDSVGYGDPLVAVLPSFHDIN 203 >ref|NP_567035.1| biotin/lipoyl attachment domain-containing protein [Arabidopsis thaliana] gi|14190387|gb|AAK55674.1|AF378871_1 AT3g56130/F18O21_90 [Arabidopsis thaliana] gi|15215875|gb|AAK91481.1| AT3g56130/F18O21_90 [Arabidopsis thaliana] gi|332645960|gb|AEE79481.1| biotin/lipoyl attachment domain-containing protein [Arabidopsis thaliana] Length = 281 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 286 VAGEVLKLLYNEGEAVGYGDPLVAVLPSFHGIN 188 VAGEVLKLL ++G++VGYGDPLVAVLPSFH IN Sbjct: 247 VAGEVLKLLSDDGDSVGYGDPLVAVLPSFHDIN 279 >ref|NP_001190101.1| biotin/lipoyl attachment domain-containing protein [Arabidopsis thaliana] gi|7572911|emb|CAB87412.1| putative protein [Arabidopsis thaliana] gi|332645963|gb|AEE79484.1| biotin/lipoyl attachment domain-containing protein [Arabidopsis thaliana] Length = 274 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 286 VAGEVLKLLYNEGEAVGYGDPLVAVLPSFHGIN 188 VAGEVLKLL ++G++VGYGDPLVAVLPSFH IN Sbjct: 240 VAGEVLKLLSDDGDSVGYGDPLVAVLPSFHDIN 272 >ref|XP_002876350.1| biotin/lipoyl attachment domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322188|gb|EFH52609.1| biotin/lipoyl attachment domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 281 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -2 Query: 286 VAGEVLKLLYNEGEAVGYGDPLVAVLPSFHGIN 188 VAGEVLKLL ++G++VGYGDPLVA+LPSFH IN Sbjct: 247 VAGEVLKLLSDDGDSVGYGDPLVAILPSFHDIN 279 >ref|XP_006353415.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 287 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 283 AGEVLKLLYNEGEAVGYGDPLVAVLPSFHG 194 AGEVLK+L+N+GEAVGYGDPL+AVLPSF G Sbjct: 258 AGEVLKILFNDGEAVGYGDPLIAVLPSFRG 287 >ref|XP_004500525.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like [Cicer arietinum] Length = 292 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 286 VAGEVLKLLYNEGEAVGYGDPLVAVLPSFHGIN 188 VAGEVLKLL +GE VGYGDPL+AVLPSFH IN Sbjct: 258 VAGEVLKLLLEDGEPVGYGDPLLAVLPSFHDIN 290 >ref|XP_006435833.1| hypothetical protein CICLE_v10032300mg [Citrus clementina] gi|568865761|ref|XP_006486239.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like [Citrus sinensis] gi|557538029|gb|ESR49073.1| hypothetical protein CICLE_v10032300mg [Citrus clementina] Length = 287 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -2 Query: 286 VAGEVLKLLYNEGEAVGYGDPLVAVLPSFHGI 191 VAGEVLKLL+++G+AVG+GDPL+AVLPSFH I Sbjct: 255 VAGEVLKLLFDDGDAVGFGDPLIAVLPSFHDI 286