BLASTX nr result
ID: Akebia26_contig00009319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00009319 (299 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529494.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002529494.1| conserved hypothetical protein [Ricinus communis] gi|223531052|gb|EEF32904.1| conserved hypothetical protein [Ricinus communis] Length = 1115 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/47 (61%), Positives = 33/47 (70%) Frame = +2 Query: 2 LKALPDGLQRVTTLQKLTLVGMSVELKARVKPNEGEDWRKIAHVPNI 142 L LPDGLQ V TL KL L M + L AR+K NEGEDW K+AH+ NI Sbjct: 1066 LGMLPDGLQHVKTLSKLKLTNMPM-LSARIKDNEGEDWDKVAHILNI 1111