BLASTX nr result
ID: Akebia26_contig00009139
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00009139 (614 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGS56990.1| phytochelatin synthase 1 [Pyrus calleryana] 67 4e-09 gb|AEY68568.1| phytochelatin synthase [Pyrus betulifolia] gi|373... 67 4e-09 ref|XP_007050223.1| Phytochelatin synthase 1 (PCS1) [Theobroma c... 67 5e-09 ref|XP_004493799.1| PREDICTED: glutathione gamma-glutamylcystein... 66 7e-09 ref|NP_001235576.1| homo-phytochelatin synthase [Glycine max] gi... 66 7e-09 ref|XP_006443794.1| hypothetical protein CICLE_v10019812mg [Citr... 65 2e-08 gb|AFK47465.1| unknown [Lotus japonicus] 65 2e-08 gb|ACT87974.1| phytochelatin synthase isoform 3 [Sesbania rostra... 65 2e-08 ref|XP_002529835.1| conserved hypothetical protein [Ricinus comm... 65 2e-08 gb|AAY83876.1| phytochelatin synthase [Sesbania rostrata] 65 2e-08 ref|XP_006604501.1| PREDICTED: glutathione gamma-glutamylcystein... 64 3e-08 ref|XP_003554294.1| PREDICTED: glutathione gamma-glutamylcystein... 64 3e-08 gb|EXB53498.1| Glutathione gamma-glutamylcysteinyltransferase 1 ... 64 5e-08 sp|Q2TSC7.1|PCS1_LOTJA RecName: Full=Glutathione gamma-glutamylc... 63 6e-08 gb|AFM38979.1| phytochelatin synthase [Sophora viciifolia] 62 1e-07 ref|XP_007200974.1| hypothetical protein PRUPE_ppa004593mg [Prun... 61 2e-07 ref|XP_002320626.2| Cadmium sensitive 1 family protein [Populus ... 61 3e-07 ref|XP_004289969.1| PREDICTED: glutathione gamma-glutamylcystein... 61 3e-07 gb|AEW23125.1| phytochelatin synthase [Amaranthus tricolor] 57 3e-06 gb|AAD16046.1| phytochelatin synthase 1 [Arabidopsis thaliana] 57 4e-06 >gb|AGS56990.1| phytochelatin synthase 1 [Pyrus calleryana] Length = 497 Score = 67.0 bits (162), Expect = 4e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 611 NLPTSLQEEVLHLRRQLHFLKKCQERKVDDDLGSP 507 NLPT LQEEVLHLRRQLH LKKCQE +VDDDLGSP Sbjct: 461 NLPTLLQEEVLHLRRQLHLLKKCQEDRVDDDLGSP 495 >gb|AEY68568.1| phytochelatin synthase [Pyrus betulifolia] gi|373405320|gb|AEY68569.1| phytochelatin synthase [Pyrus betulifolia] Length = 497 Score = 67.0 bits (162), Expect = 4e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 611 NLPTSLQEEVLHLRRQLHFLKKCQERKVDDDLGSP 507 NLPT LQEEVLHLRRQLH LKKCQE +VDDDLGSP Sbjct: 461 NLPTLLQEEVLHLRRQLHLLKKCQEDRVDDDLGSP 495 >ref|XP_007050223.1| Phytochelatin synthase 1 (PCS1) [Theobroma cacao] gi|508702484|gb|EOX94380.1| Phytochelatin synthase 1 (PCS1) [Theobroma cacao] Length = 505 Score = 66.6 bits (161), Expect = 5e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 614 ENLPTSLQEEVLHLRRQLHFLKKCQERKVDDDLGSP 507 +NLPT LQEEVLHLRRQLH LKKCQE KVD+DLG+P Sbjct: 468 KNLPTLLQEEVLHLRRQLHLLKKCQENKVDEDLGAP 503 >ref|XP_004493799.1| PREDICTED: glutathione gamma-glutamylcysteinyltransferase 1-like [Cicer arietinum] Length = 499 Score = 66.2 bits (160), Expect = 7e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 614 ENLPTSLQEEVLHLRRQLHFLKKCQERKVDDDLGSP 507 ENLPT LQEEVLHLRRQLH LK+CQE KVD+DLG+P Sbjct: 462 ENLPTLLQEEVLHLRRQLHILKRCQEGKVDEDLGAP 497 >ref|NP_001235576.1| homo-phytochelatin synthase [Glycine max] gi|18699092|gb|AAL78384.1|AF411075_1 homo-phytochelatin synthase [Glycine max] Length = 498 Score = 66.2 bits (160), Expect = 7e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 614 ENLPTSLQEEVLHLRRQLHFLKKCQERKVDDDLGSP 507 ENLPT LQEEVLHLRRQLH LK+CQE KVD+DLG+P Sbjct: 461 ENLPTLLQEEVLHLRRQLHLLKRCQEGKVDEDLGAP 496 >ref|XP_006443794.1| hypothetical protein CICLE_v10019812mg [Citrus clementina] gi|568851641|ref|XP_006479496.1| PREDICTED: glutathione gamma-glutamylcysteinyltransferase 1-like isoform X2 [Citrus sinensis] gi|557546056|gb|ESR57034.1| hypothetical protein CICLE_v10019812mg [Citrus clementina] Length = 503 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 614 ENLPTSLQEEVLHLRRQLHFLKKCQERKVDDDLGSPS 504 ENLPT LQEEVLHLRRQLH L++CQE KVD+DL +PS Sbjct: 466 ENLPTLLQEEVLHLRRQLHILRRCQENKVDEDLAAPS 502 >gb|AFK47465.1| unknown [Lotus japonicus] Length = 503 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -1 Query: 614 ENLPTSLQEEVLHLRRQLHFLKKCQERKVDDDLGSPSF 501 ENLP LQEEVLHLRRQLH LK+CQE KVD+DLG P F Sbjct: 466 ENLPALLQEEVLHLRRQLHILKRCQEGKVDEDLGVPLF 503 >gb|ACT87974.1| phytochelatin synthase isoform 3 [Sesbania rostrata] gi|254935139|gb|ACT87977.1| phytochelatin synthase isoform 3 [Sesbania rostrata] Length = 501 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -1 Query: 614 ENLPTSLQEEVLHLRRQLHFLKKCQERKVDDDLGSP 507 ENLPT LQEEVLHLRRQLH LK+CQE K+D+DLG P Sbjct: 464 ENLPTLLQEEVLHLRRQLHILKRCQEGKIDEDLGVP 499 >ref|XP_002529835.1| conserved hypothetical protein [Ricinus communis] gi|223530663|gb|EEF32536.1| conserved hypothetical protein [Ricinus communis] Length = 502 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 614 ENLPTSLQEEVLHLRRQLHFLKKCQERKVDDDLGSP 507 ENLPT LQEEVLHLRRQL+ LK+CQE KVD+DLG+P Sbjct: 465 ENLPTLLQEEVLHLRRQLYLLKRCQENKVDEDLGAP 500 >gb|AAY83876.1| phytochelatin synthase [Sesbania rostrata] Length = 465 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -1 Query: 614 ENLPTSLQEEVLHLRRQLHFLKKCQERKVDDDLGSP 507 ENLPT LQEEVLHLRRQLH LK+CQE K+D+DLG P Sbjct: 428 ENLPTLLQEEVLHLRRQLHILKRCQEGKIDEDLGVP 463 >ref|XP_006604501.1| PREDICTED: glutathione gamma-glutamylcysteinyltransferase 1-like isoform X2 [Glycine max] Length = 461 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -1 Query: 614 ENLPTSLQEEVLHLRRQLHFLKKCQERKVDDDLGSP 507 ENLPT LQEEVLHLR QLH LK+CQE KVD+DLG+P Sbjct: 424 ENLPTLLQEEVLHLRHQLHLLKRCQEGKVDEDLGAP 459 >ref|XP_003554294.1| PREDICTED: glutathione gamma-glutamylcysteinyltransferase 1-like isoform X1 [Glycine max] Length = 497 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -1 Query: 614 ENLPTSLQEEVLHLRRQLHFLKKCQERKVDDDLGSP 507 ENLPT LQEEVLHLR QLH LK+CQE KVD+DLG+P Sbjct: 460 ENLPTLLQEEVLHLRHQLHLLKRCQEGKVDEDLGAP 495 >gb|EXB53498.1| Glutathione gamma-glutamylcysteinyltransferase 1 [Morus notabilis] Length = 502 Score = 63.5 bits (153), Expect = 5e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -1 Query: 614 ENLPTSLQEEVLHLRRQLHFLKKCQERKVDDDLGSP 507 ENLPT LQEEVLHLRRQLH LK+CQE KVD+ LG+P Sbjct: 465 ENLPTLLQEEVLHLRRQLHLLKRCQENKVDEVLGAP 500 >sp|Q2TSC7.1|PCS1_LOTJA RecName: Full=Glutathione gamma-glutamylcysteinyltransferase 1; AltName: Full=LjPCS1-8R; AltName: Full=Phytochelatin synthase 1 gi|33286859|gb|AAQ01752.1| phytochelatin synthase [Lotus japonicus] gi|50659121|gb|AAT80342.1| phytochelatin synthase PCS1-8R [Lotus japonicus] Length = 501 Score = 63.2 bits (152), Expect = 6e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -1 Query: 614 ENLPTSLQEEVLHLRRQLHFLKKCQERKVDDDLGSP 507 ENLP LQEEVLHLRRQLH LK+CQE KVD+DLG P Sbjct: 464 ENLPALLQEEVLHLRRQLHILKRCQEGKVDEDLGVP 499 >gb|AFM38979.1| phytochelatin synthase [Sophora viciifolia] Length = 500 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -1 Query: 614 ENLPTSLQEEVLHLRRQLHFLKKCQERKVDDDLGSP 507 ENLPT LQEEVLHL+ QLH LK+CQE KVD+DLG+P Sbjct: 463 ENLPTLLQEEVLHLKCQLHLLKRCQEGKVDEDLGAP 498 >ref|XP_007200974.1| hypothetical protein PRUPE_ppa004593mg [Prunus persica] gi|462396374|gb|EMJ02173.1| hypothetical protein PRUPE_ppa004593mg [Prunus persica] Length = 501 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 611 NLPTSLQEEVLHLRRQLHFLKKCQERKVDDDLGSP 507 NLPT LQEEVLHLRRQL LKKCQE +VD+DLG+P Sbjct: 465 NLPTLLQEEVLHLRRQLQLLKKCQEDRVDEDLGAP 499 >ref|XP_002320626.2| Cadmium sensitive 1 family protein [Populus trichocarpa] gi|550324488|gb|EEE98941.2| Cadmium sensitive 1 family protein [Populus trichocarpa] Length = 475 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 614 ENLPTSLQEEVLHLRRQLHFLKKCQERKVDDDLGSP 507 E+LP LQEEVLHLRRQLH LK+CQE +VD DLG+P Sbjct: 438 EHLPILLQEEVLHLRRQLHLLKRCQENRVDQDLGAP 473 >ref|XP_004289969.1| PREDICTED: glutathione gamma-glutamylcysteinyltransferase 1-like [Fragaria vesca subsp. vesca] Length = 503 Score = 60.8 bits (146), Expect = 3e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 611 NLPTSLQEEVLHLRRQLHFLKKCQERKVDDDLGSP 507 +LPT LQEEVLHLRRQLH LKKCQE ++++DLG P Sbjct: 467 SLPTLLQEEVLHLRRQLHLLKKCQENRIEEDLGEP 501 >gb|AEW23125.1| phytochelatin synthase [Amaranthus tricolor] Length = 485 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -1 Query: 611 NLPTSLQEEVLHLRRQLHFLKKCQERKVDDDLGSPSF 501 +LPT LQEEVLHLRRQL LK+CQE K +DDL +P++ Sbjct: 449 SLPTMLQEEVLHLRRQLQLLKRCQENKEEDDLAAPAY 485 >gb|AAD16046.1| phytochelatin synthase 1 [Arabidopsis thaliana] Length = 485 Score = 57.0 bits (136), Expect = 4e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -1 Query: 611 NLPTSLQEEVLHLRRQLHFLKKCQERKVDDDLGSPSF 501 +LPT LQEEVLHLRRQL LK+CQE K +DDL +P++ Sbjct: 449 SLPTLLQEEVLHLRRQLQLLKRCQENKEEDDLAAPAY 485