BLASTX nr result
ID: Akebia25_contig00059540
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00059540 (417 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON66609.1| HAL protein kinase [Coniosporium apollinis CBS 10... 97 2e-18 ref|XP_003844541.1| hypothetical protein LEMA_P021920.1 [Leptosp... 94 3e-17 gb|EOA89462.1| hypothetical protein SETTUDRAFT_105135 [Setosphae... 91 2e-16 gb|EUC42701.1| hypothetical protein COCMIDRAFT_28721 [Bipolaris ... 89 5e-16 gb|EUC33880.1| hypothetical protein COCCADRAFT_94782 [Bipolaris ... 89 5e-16 gb|EMD92037.1| hypothetical protein COCHEDRAFT_1099562 [Bipolari... 89 5e-16 gb|EMD67794.1| hypothetical protein COCSADRAFT_83062 [Bipolaris ... 89 5e-16 ref|XP_003295930.1| hypothetical protein PTT_03821 [Pyrenophora ... 89 5e-16 ref|XP_001930955.1| serine/threonine-protein kinase hal4 [Pyreno... 89 5e-16 ref|XP_001799495.1| hypothetical protein SNOG_09194 [Phaeosphaer... 88 1e-15 gb|EKG09879.1| hypothetical protein MPH_13086 [Macrophomina phas... 84 2e-14 gb|EZF34407.1| HAL protein kinase [Trichophyton interdigitale H6] 82 8e-14 ref|XP_003235156.1| HAL protein kinase [Trichophyton rubrum CBS ... 82 8e-14 ref|XP_003173700.1| HAL protein kinase [Arthroderma gypseum CBS ... 82 8e-14 ref|XP_003025462.1| serine/threonine protein kinase, putative [T... 82 8e-14 ref|XP_002844798.1| serine/threonine-protein kinase hal4 [Arthro... 82 8e-14 gb|EJT74390.1| HAL protein kinase [Gaeumannomyces graminis var. ... 81 1e-13 gb|EGE83159.1| serine/threonine protein kinase [Ajellomyces derm... 81 1e-13 gb|EGC44856.1| serine/threonine protein kinase hal4 [Ajellomyces... 81 1e-13 ref|XP_002625196.1| serine/threonine protein kinase [Ajellomyces... 81 1e-13 >gb|EON66609.1| HAL protein kinase [Coniosporium apollinis CBS 100218] Length = 516 Score = 97.1 bits (240), Expect = 2e-18 Identities = 41/52 (78%), Positives = 49/52 (94%) Frame = +3 Query: 3 REETGFRPIEILRRRQCRNVIYSVLDPNPVRRLTAHQVLLSEWIKDVKVCKA 158 REE G+RPIE+L+RRQCRNVIYS+LDPNP RRLTAHQVL SEW+KD++VC+A Sbjct: 460 REEEGYRPIEVLKRRQCRNVIYSILDPNPTRRLTAHQVLQSEWVKDIRVCRA 511 >ref|XP_003844541.1| hypothetical protein LEMA_P021920.1 [Leptosphaeria maculans JN3] gi|312221121|emb|CBY01062.1| hypothetical protein LEMA_P021920.1 [Leptosphaeria maculans JN3] Length = 489 Score = 93.6 bits (231), Expect = 3e-17 Identities = 40/52 (76%), Positives = 47/52 (90%) Frame = +3 Query: 3 REETGFRPIEILRRRQCRNVIYSVLDPNPVRRLTAHQVLLSEWIKDVKVCKA 158 +EE G+RPIE+LRRRQCRNVIYS+LDPNP RRLTAHQVL+SEW+ + KVC A Sbjct: 433 KEEEGYRPIEVLRRRQCRNVIYSILDPNPTRRLTAHQVLVSEWVSEAKVCHA 484 >gb|EOA89462.1| hypothetical protein SETTUDRAFT_105135 [Setosphaeria turcica Et28A] Length = 421 Score = 90.5 bits (223), Expect = 2e-16 Identities = 39/52 (75%), Positives = 46/52 (88%) Frame = +3 Query: 3 REETGFRPIEILRRRQCRNVIYSVLDPNPVRRLTAHQVLLSEWIKDVKVCKA 158 +EE G+RPIE+LRRRQCRNVIYS+LDP P RRLTAHQVL SEW+ + KVC+A Sbjct: 365 KEEEGYRPIEVLRRRQCRNVIYSILDPIPARRLTAHQVLASEWVSEAKVCRA 416 >gb|EUC42701.1| hypothetical protein COCMIDRAFT_28721 [Bipolaris oryzae ATCC 44560] Length = 498 Score = 89.4 bits (220), Expect = 5e-16 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = +3 Query: 3 REETGFRPIEILRRRQCRNVIYSVLDPNPVRRLTAHQVLLSEWIKDVKVCKA 158 ++E G+RPIE+LRRRQCRNVIYS+LDP P RRLTAHQVL SEW+ + KVC+A Sbjct: 442 KQEEGYRPIEVLRRRQCRNVIYSILDPIPARRLTAHQVLASEWVSEAKVCRA 493 >gb|EUC33880.1| hypothetical protein COCCADRAFT_94782 [Bipolaris zeicola 26-R-13] gi|578483646|gb|EUN21203.1| hypothetical protein COCVIDRAFT_114608 [Bipolaris victoriae FI3] Length = 420 Score = 89.4 bits (220), Expect = 5e-16 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = +3 Query: 3 REETGFRPIEILRRRQCRNVIYSVLDPNPVRRLTAHQVLLSEWIKDVKVCKA 158 ++E G+RPIE+LRRRQCRNVIYS+LDP P RRLTAHQVL SEW+ + KVC+A Sbjct: 364 KQEEGYRPIEVLRRRQCRNVIYSILDPIPARRLTAHQVLASEWVSEAKVCRA 415 >gb|EMD92037.1| hypothetical protein COCHEDRAFT_1099562 [Bipolaris maydis C5] gi|477585390|gb|ENI02478.1| hypothetical protein COCC4DRAFT_144737 [Bipolaris maydis ATCC 48331] Length = 420 Score = 89.4 bits (220), Expect = 5e-16 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = +3 Query: 3 REETGFRPIEILRRRQCRNVIYSVLDPNPVRRLTAHQVLLSEWIKDVKVCKA 158 ++E G+RPIE+LRRRQCRNVIYS+LDP P RRLTAHQVL SEW+ + KVC+A Sbjct: 364 KQEEGYRPIEVLRRRQCRNVIYSILDPIPARRLTAHQVLASEWVSEAKVCRA 415 >gb|EMD67794.1| hypothetical protein COCSADRAFT_83062 [Bipolaris sorokiniana ND90Pr] Length = 420 Score = 89.4 bits (220), Expect = 5e-16 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = +3 Query: 3 REETGFRPIEILRRRQCRNVIYSVLDPNPVRRLTAHQVLLSEWIKDVKVCKA 158 ++E G+RPIE+LRRRQCRNVIYS+LDP P RRLTAHQVL SEW+ + KVC+A Sbjct: 364 KQEEGYRPIEVLRRRQCRNVIYSILDPIPARRLTAHQVLASEWVSEAKVCRA 415 >ref|XP_003295930.1| hypothetical protein PTT_03821 [Pyrenophora teres f. teres 0-1] gi|311332332|gb|EFQ95973.1| hypothetical protein PTT_03821 [Pyrenophora teres f. teres 0-1] Length = 421 Score = 89.4 bits (220), Expect = 5e-16 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = +3 Query: 3 REETGFRPIEILRRRQCRNVIYSVLDPNPVRRLTAHQVLLSEWIKDVKVCKA 158 ++E G+RPIE+LRRRQCRNVIYS+LDP P RRLTAHQVL SEW+ + KVC+A Sbjct: 365 KQEEGYRPIEVLRRRQCRNVIYSILDPIPARRLTAHQVLASEWVSEAKVCRA 416 >ref|XP_001930955.1| serine/threonine-protein kinase hal4 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187972561|gb|EDU40060.1| serine/threonine-protein kinase hal4 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 474 Score = 89.4 bits (220), Expect = 5e-16 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = +3 Query: 3 REETGFRPIEILRRRQCRNVIYSVLDPNPVRRLTAHQVLLSEWIKDVKVCKA 158 ++E G+RPIE+LRRRQCRNVIYS+LDP P RRLTAHQVL SEW+ + KVC+A Sbjct: 418 KQEEGYRPIEVLRRRQCRNVIYSILDPIPARRLTAHQVLASEWVSEAKVCRA 469 >ref|XP_001799495.1| hypothetical protein SNOG_09194 [Phaeosphaeria nodorum SN15] gi|160702445|gb|EAT83386.2| hypothetical protein SNOG_09194 [Phaeosphaeria nodorum SN15] Length = 378 Score = 88.2 bits (217), Expect = 1e-15 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = +3 Query: 3 REETGFRPIEILRRRQCRNVIYSVLDPNPVRRLTAHQVLLSEWIKDVKVCKA 158 ++E G+RPIE+LRRRQCRNVIYS+LDP P RRLTAHQVL SEW+ + KVC A Sbjct: 322 KQEEGYRPIEVLRRRQCRNVIYSILDPIPARRLTAHQVLASEWVSEAKVCHA 373 >gb|EKG09879.1| hypothetical protein MPH_13086 [Macrophomina phaseolina MS6] Length = 523 Score = 84.0 bits (206), Expect = 2e-14 Identities = 35/52 (67%), Positives = 46/52 (88%) Frame = +3 Query: 3 REETGFRPIEILRRRQCRNVIYSVLDPNPVRRLTAHQVLLSEWIKDVKVCKA 158 +EE+G+RPIE+LRRRQCRNVIYS+LDPNP RRLTA +V SEW+ +++C+A Sbjct: 467 KEESGYRPIEVLRRRQCRNVIYSILDPNPNRRLTAEEVNRSEWVDQIRLCRA 518 >gb|EZF34407.1| HAL protein kinase [Trichophyton interdigitale H6] Length = 557 Score = 82.0 bits (201), Expect = 8e-14 Identities = 35/52 (67%), Positives = 44/52 (84%) Frame = +3 Query: 3 REETGFRPIEILRRRQCRNVIYSVLDPNPVRRLTAHQVLLSEWIKDVKVCKA 158 R+E G+ PIE L R +CRNVIYS+LDPNP RR+TA QVL SEW++D+K+CKA Sbjct: 501 RDEDGYAPIETLHRARCRNVIYSILDPNPGRRITASQVLKSEWVRDIKLCKA 552 >ref|XP_003235156.1| HAL protein kinase [Trichophyton rubrum CBS 118892] gi|326462508|gb|EGD87961.1| HAL protein kinase [Trichophyton rubrum CBS 118892] gi|607877842|gb|EZF22955.1| HAL protein kinase [Trichophyton rubrum MR850] gi|607904361|gb|EZF41781.1| HAL protein kinase [Trichophyton rubrum CBS 100081] gi|607916506|gb|EZF52474.1| HAL protein kinase [Trichophyton rubrum CBS 288.86] gi|607928534|gb|EZF63057.1| HAL protein kinase [Trichophyton rubrum CBS 289.86] gi|607940410|gb|EZF73640.1| HAL protein kinase [Trichophyton soudanense CBS 452.61] gi|607952525|gb|EZF84363.1| HAL protein kinase [Trichophyton rubrum MR1448] gi|607964768|gb|EZF95156.1| HAL protein kinase [Trichophyton rubrum MR1459] gi|607976979|gb|EZG06153.1| HAL protein kinase [Trichophyton rubrum CBS 735.88] gi|607988648|gb|EZG16605.1| HAL protein kinase [Trichophyton rubrum CBS 202.88] Length = 554 Score = 82.0 bits (201), Expect = 8e-14 Identities = 35/52 (67%), Positives = 44/52 (84%) Frame = +3 Query: 3 REETGFRPIEILRRRQCRNVIYSVLDPNPVRRLTAHQVLLSEWIKDVKVCKA 158 R+E G+ PIE L R +CRNVIYS+LDPNP RR+TA QVL SEW++D+K+CKA Sbjct: 498 RDEDGYAPIETLHRARCRNVIYSILDPNPGRRITASQVLKSEWVRDIKLCKA 549 >ref|XP_003173700.1| HAL protein kinase [Arthroderma gypseum CBS 118893] gi|311341667|gb|EFR00870.1| HAL protein kinase [Arthroderma gypseum CBS 118893] Length = 545 Score = 82.0 bits (201), Expect = 8e-14 Identities = 35/52 (67%), Positives = 44/52 (84%) Frame = +3 Query: 3 REETGFRPIEILRRRQCRNVIYSVLDPNPVRRLTAHQVLLSEWIKDVKVCKA 158 R+E G+ PIE L R +CRNVIYS+LDPNP RR+TA QVL SEW++D+K+CKA Sbjct: 489 RDEDGYAPIETLHRARCRNVIYSILDPNPGRRITASQVLKSEWVRDIKLCKA 540 >ref|XP_003025462.1| serine/threonine protein kinase, putative [Trichophyton verrucosum HKI 0517] gi|291189573|gb|EFE44851.1| serine/threonine protein kinase, putative [Trichophyton verrucosum HKI 0517] Length = 778 Score = 82.0 bits (201), Expect = 8e-14 Identities = 35/52 (67%), Positives = 44/52 (84%) Frame = +3 Query: 3 REETGFRPIEILRRRQCRNVIYSVLDPNPVRRLTAHQVLLSEWIKDVKVCKA 158 R+E G+ PIE L R +CRNVIYS+LDPNP RR+TA QVL SEW++D+K+CKA Sbjct: 722 RDEDGYAPIETLHRARCRNVIYSILDPNPGRRITASQVLKSEWVRDIKLCKA 773 >ref|XP_002844798.1| serine/threonine-protein kinase hal4 [Arthroderma otae CBS 113480] gi|238844281|gb|EEQ33943.1| serine/threonine-protein kinase hal4 [Arthroderma otae CBS 113480] Length = 544 Score = 82.0 bits (201), Expect = 8e-14 Identities = 35/52 (67%), Positives = 44/52 (84%) Frame = +3 Query: 3 REETGFRPIEILRRRQCRNVIYSVLDPNPVRRLTAHQVLLSEWIKDVKVCKA 158 R+E G+ PIE L R +CRNVIYS+LDPNP RR+TA QVL SEW++D+K+CKA Sbjct: 488 RDEDGYAPIETLHRARCRNVIYSILDPNPGRRITASQVLKSEWVRDIKLCKA 539 >gb|EJT74390.1| HAL protein kinase [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 497 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/52 (67%), Positives = 44/52 (84%) Frame = +3 Query: 3 REETGFRPIEILRRRQCRNVIYSVLDPNPVRRLTAHQVLLSEWIKDVKVCKA 158 R+E G+RPIE L R +CRNVIYS+LDPNP RR+TA QVL SEW +++K+CKA Sbjct: 441 RDEEGYRPIETLHRARCRNVIYSILDPNPTRRITASQVLKSEWGREIKLCKA 492 >gb|EGE83159.1| serine/threonine protein kinase [Ajellomyces dermatitidis ATCC 18188] gi|531978125|gb|EQL28712.1| HAL protein kinase [Ajellomyces dermatitidis ATCC 26199] Length = 509 Score = 81.3 bits (199), Expect = 1e-13 Identities = 33/52 (63%), Positives = 44/52 (84%) Frame = +3 Query: 3 REETGFRPIEILRRRQCRNVIYSVLDPNPVRRLTAHQVLLSEWIKDVKVCKA 158 R+E G+ PIE L R +CRNVIYS+LDPNP RR+TA QVL SEW++++++CKA Sbjct: 453 RDEDGYAPIETLHRARCRNVIYSILDPNPTRRITASQVLKSEWVREIRICKA 504 >gb|EGC44856.1| serine/threonine protein kinase hal4 [Ajellomyces capsulatus H88] Length = 477 Score = 81.3 bits (199), Expect = 1e-13 Identities = 33/52 (63%), Positives = 44/52 (84%) Frame = +3 Query: 3 REETGFRPIEILRRRQCRNVIYSVLDPNPVRRLTAHQVLLSEWIKDVKVCKA 158 R+E G+ PIE L R +CRNVIYS+LDPNP RR+TA QVL SEW++++++CKA Sbjct: 421 RDEDGYAPIETLHRARCRNVIYSILDPNPTRRITASQVLKSEWVREIRICKA 472 >ref|XP_002625196.1| serine/threonine protein kinase [Ajellomyces dermatitidis SLH14081] gi|239595159|gb|EEQ77740.1| serine/threonine protein kinase [Ajellomyces dermatitidis SLH14081] Length = 509 Score = 81.3 bits (199), Expect = 1e-13 Identities = 33/52 (63%), Positives = 44/52 (84%) Frame = +3 Query: 3 REETGFRPIEILRRRQCRNVIYSVLDPNPVRRLTAHQVLLSEWIKDVKVCKA 158 R+E G+ PIE L R +CRNVIYS+LDPNP RR+TA QVL SEW++++++CKA Sbjct: 453 RDEDGYAPIETLHRARCRNVIYSILDPNPTRRITASQVLKSEWVREIRICKA 504