BLASTX nr result
ID: Akebia25_contig00052486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00052486 (352 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_054986.1| ORF45 protein [Spinacia oleracea] gi|7636160|em... 64 3e-08 gb|ABN08797.1| hypothetical protein MtrDRAFT_AC160516g49v2 [Medi... 57 4e-06 >ref|NP_054986.1| ORF45 protein [Spinacia oleracea] gi|7636160|emb|CAB88782.1| ORF45 protein [Spinacia oleracea] Length = 45 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 258 MGYYDFEQAAMVKSVDTLLLGSSARASRFESEWRH 154 MGYYDF++AAMVK VDTLLLGSSARASRFESE RH Sbjct: 1 MGYYDFKEAAMVKLVDTLLLGSSARASRFESESRH 35 >gb|ABN08797.1| hypothetical protein MtrDRAFT_AC160516g49v2 [Medicago truncatula] Length = 40 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +2 Query: 155 CRHSDSNRDALALLPKSSVSTDFTIAACSKS 247 CR+SDSNRDALALLPKSSVST+FTIAA SKS Sbjct: 10 CRYSDSNRDALALLPKSSVSTNFTIAAYSKS 40