BLASTX nr result
ID: Akebia25_contig00052327
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00052327 (450 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON69331.1| hypothetical protein W97_08591 [Coniosporium apol... 57 3e-06 >gb|EON69331.1| hypothetical protein W97_08591 [Coniosporium apollinis CBS 100218] Length = 245 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = +3 Query: 312 PPTMADHNQQPTAGTSATQPPTSASQLPPEALDLATKLFDLARSGS 449 PP D QP+ T+ QPP++ S+LPP ALDLA K+FDLAR+G+ Sbjct: 13 PPANTDPIAQPSQSTTTAQPPSTPSELPPAALDLAAKIFDLARTGA 58