BLASTX nr result
ID: Akebia25_contig00052229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00052229 (245 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF13771.1| E1_DerP2_DerF2-domain-containing protein [Sphaeru... 72 1e-10 ref|XP_003852196.1| hypothetical protein MYCGRDRAFT_72138 [Zymos... 69 9e-10 gb|EMC93340.1| hypothetical protein BAUCODRAFT_52594, partial [B... 67 2e-09 ref|XP_001821955.1| phosphatidylglycerol/phosphatidylinositol tr... 67 3e-09 gb|EME38243.1| hypothetical protein DOTSEDRAFT_75719 [Dothistrom... 64 2e-08 ref|XP_003065060.1| phosphatidylglycerol/phosphatidylinositol tr... 64 2e-08 ref|XP_001241035.1| hypothetical protein CIMG_08198 [Coccidioide... 64 2e-08 ref|XP_663483.1| hypothetical protein AN5879.2 [Aspergillus nidu... 64 2e-08 dbj|GAD93867.1| ML domain protein [Byssochlamys spectabilis No. 5] 64 3e-08 ref|XP_003834246.1| hypothetical protein LEMA_P059150.1 [Leptosp... 64 3e-08 ref|XP_001909168.1| hypothetical protein [Podospora anserina S m... 64 3e-08 gb|EEQ91301.1| phosphatidylglycerol/phosphatidylinositol transfe... 63 5e-08 ref|XP_002629361.1| phosphatidylglycerol/phosphatidylinositol tr... 63 5e-08 ref|XP_002542932.1| phosphatidylglycerol/phosphatidylinositol tr... 62 6e-08 gb|EUC44289.1| hypothetical protein COCMIDRAFT_27352 [Bipolaris ... 62 1e-07 gb|EMD94054.1| hypothetical protein COCHEDRAFT_100154 [Bipolaris... 62 1e-07 gb|EUC29389.1| hypothetical protein COCCADRAFT_40216 [Bipolaris ... 61 1e-07 gb|ETN47207.1| hypothetical protein HMPREF1541_01398 [Cyphelloph... 61 1e-07 gb|EME79368.1| hypothetical protein MYCFIDRAFT_112427, partial [... 60 2e-07 gb|EXJ58371.1| hypothetical protein A1O7_05796 [Cladophialophora... 60 3e-07 >gb|EMF13771.1| E1_DerP2_DerF2-domain-containing protein [Sphaerulina musiva SO2202] Length = 175 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -3 Query: 132 DDALSVPGDNPLQYCAKPEKDILEIQKVDLSPNPPKAGTTLTVT 1 D LSVPG+NPL++C P++DIL I+KVDLSPNPPKAG+TLT+T Sbjct: 26 DSNLSVPGENPLEHCKDPKEDILAIKKVDLSPNPPKAGSTLTIT 69 >ref|XP_003852196.1| hypothetical protein MYCGRDRAFT_72138 [Zymoseptoria tritici IPO323] gi|339472077|gb|EGP87172.1| hypothetical protein MYCGRDRAFT_72138 [Zymoseptoria tritici IPO323] Length = 178 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/54 (55%), Positives = 42/54 (77%) Frame = -3 Query: 162 FSSKPQKALVDDALSVPGDNPLQYCAKPEKDILEIQKVDLSPNPPKAGTTLTVT 1 F S A +D L++PG+NPL++CA P+ DIL ++KVDL+PNPP+AGT LT+T Sbjct: 22 FFSISDAAPLDANLAIPGENPLEHCADPKDDILALKKVDLNPNPPRAGTELTIT 75 >gb|EMC93340.1| hypothetical protein BAUCODRAFT_52594, partial [Baudoinia compniacensis UAMH 10762] Length = 139 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -3 Query: 135 VDDALSVPGDNPLQYCAKPEKDILEIQKVDLSPNPPKAGTTLTVT 1 VDD+LSVPG+NPL +C P D+L +++VDL PNPPK G LTVT Sbjct: 1 VDDSLSVPGENPLHHCKDPANDVLSLERVDLDPNPPKPGQNLTVT 45 >ref|XP_001821955.1| phosphatidylglycerol/phosphatidylinositol transfer protein [Aspergillus oryzae RIB40] gi|238496391|ref|XP_002379431.1| ML domain protein, putative [Aspergillus flavus NRRL3357] gi|73621318|sp|O94183.1|NPC2_ASPOR RecName: Full=Phosphatidylglycerol/phosphatidylinositol transfer protein; Short=PG/PI-TP; Flags: Precursor gi|10178615|gb|AAG13652.1|AF154412_1 phosphatidylglycerol/phosphatidylinositol transfer protein [Aspergillus oryzae] gi|4322563|gb|AAD16095.1| phosphatidylglycerol/phosphatidylinositol transfer protein [Aspergillus oryzae] gi|83769818|dbj|BAE59953.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220694311|gb|EED50655.1| ML domain protein, putative [Aspergillus flavus NRRL3357] gi|391868926|gb|EIT78135.1| phosphatidylglycerol/phosphatidylinositol transfer protein [Aspergillus oryzae 3.042] Length = 175 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/56 (55%), Positives = 38/56 (67%) Frame = -3 Query: 168 LDFSSKPQKALVDDALSVPGDNPLQYCAKPEKDILEIQKVDLSPNPPKAGTTLTVT 1 LDF Q + A SVPG+NPL+YC P DIL+I++VDLSPNPP G TL +T Sbjct: 24 LDFFKSSQSPIQAQAKSVPGNNPLEYCNDPSGDILDIKQVDLSPNPPLPGKTLAIT 79 >gb|EME38243.1| hypothetical protein DOTSEDRAFT_75719 [Dothistroma septosporum NZE10] Length = 180 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -3 Query: 132 DDALSVPGDNPLQYCAKPEKDILEIQKVDLSPNPPKAGTTLTVT 1 D SVPGDNPL++CA P+ D+L I+ VDL PNPP AG TL++T Sbjct: 34 DTKFSVPGDNPLEHCADPKDDVLAIKSVDLDPNPPLAGKTLSIT 77 >ref|XP_003065060.1| phosphatidylglycerol/phosphatidylinositol transfer protein, putative [Coccidioides posadasii C735 delta SOWgp] gi|240104719|gb|EER22915.1| phosphatidylglycerol/phosphatidylinositol transfer protein, putative [Coccidioides posadasii C735 delta SOWgp] gi|320033224|gb|EFW15173.1| ML domain-containing protein [Coccidioides posadasii str. Silveira] Length = 174 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -3 Query: 135 VDDALSVPGDNPLQYCAKPEKDILEIQKVDLSPNPPKAGTTLTV 4 +DD LSVPG+NPL +C+ P DIL I++VDL PNPP G TLT+ Sbjct: 35 IDDDLSVPGENPLSFCSSPATDILTIERVDLFPNPPLPGKTLTI 78 >ref|XP_001241035.1| hypothetical protein CIMG_08198 [Coccidioides immitis RS] gi|392867000|gb|EAS29815.2| ML domain-containing protein [Coccidioides immitis RS] Length = 174 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -3 Query: 135 VDDALSVPGDNPLQYCAKPEKDILEIQKVDLSPNPPKAGTTLTV 4 +DD LSVPG+NPL +C+ P DIL I++VDL PNPP G TLT+ Sbjct: 35 IDDDLSVPGENPLSFCSSPATDILTIERVDLFPNPPLPGKTLTI 78 >ref|XP_663483.1| hypothetical protein AN5879.2 [Aspergillus nidulans FGSC A4] gi|73621323|sp|Q5B0Q1.1|NPC2_EMENI RecName: Full=Phosphatidylglycerol/phosphatidylinositol transfer protein; Short=PG/PI-TP; Flags: Precursor gi|40739198|gb|EAA58388.1| hypothetical protein AN5879.2 [Aspergillus nidulans FGSC A4] gi|259479955|tpe|CBF70649.1| TPA: Phosphatidylglycerol/phosphatidylinositol transfer protein Precursor (PG/PI-TP) [Source:UniProtKB/Swiss-Prot;Acc:Q5B0Q1] [Aspergillus nidulans FGSC A4] Length = 169 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -3 Query: 138 LVDDALSVPGDNPLQYCAKPEKDILEIQKVDLSPNPPKAGTTLTV 4 ++ + V GDNPL+YC++P DILEI VDL+PNPPKAGTTL + Sbjct: 32 VIAEGAPVRGDNPLEYCSEPSGDILEINSVDLAPNPPKAGTTLKI 76 >dbj|GAD93867.1| ML domain protein [Byssochlamys spectabilis No. 5] Length = 176 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/54 (51%), Positives = 36/54 (66%) Frame = -3 Query: 165 DFSSKPQKALVDDALSVPGDNPLQYCAKPEKDILEIQKVDLSPNPPKAGTTLTV 4 DF+ + + D A V GDNPL YC+ P +IL+I VDLSPNPP+ G TLT+ Sbjct: 28 DFNQQSPISTADKAFPVAGDNPLTYCSDPSNNILQIDSVDLSPNPPQPGQTLTI 81 >ref|XP_003834246.1| hypothetical protein LEMA_P059150.1 [Leptosphaeria maculans JN3] gi|312210795|emb|CBX90881.1| hypothetical protein LEMA_P059150.1 [Leptosphaeria maculans JN3] Length = 674 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = -3 Query: 144 KALVDDALSVPGDNPLQYCAKPEKDILEIQKVDLSPNPPKAGTTLTV 4 + +V + VPGDNPL +C P DIL+I+KVDLSPNPPK G TL++ Sbjct: 534 QVVVKEEYKVPGDNPLYFCGDPADDILKIEKVDLSPNPPKPGETLSI 580 >ref|XP_001909168.1| hypothetical protein [Podospora anserina S mat+] gi|170944190|emb|CAP70300.1| unnamed protein product [Podospora anserina S mat+] Length = 179 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = -3 Query: 162 FSSKPQKALVDDALSVPGDNPLQYC-AKPEKDILEIQKVDLSPNPPKAGTTLTV 4 F S+ Q + D L +PGDNPL+YC A DI+ I+KVDLSPNPP+AGTTL + Sbjct: 22 FRSEKQSLVRRDDLQIPGDNPLKYCDADRGDDIITIEKVDLSPNPPEAGTTLII 75 >gb|EEQ91301.1| phosphatidylglycerol/phosphatidylinositol transfer protein [Ajellomyces dermatitidis ER-3] gi|327354885|gb|EGE83742.1| hypothetical protein BDDG_06687 [Ajellomyces dermatitidis ATCC 18188] Length = 174 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/47 (61%), Positives = 33/47 (70%) Frame = -3 Query: 141 ALVDDALSVPGDNPLQYCAKPEKDILEIQKVDLSPNPPKAGTTLTVT 1 +L + L VPGDNPL +C PE DIL I VDLSPNPP G TLT+T Sbjct: 35 SLAGNELRVPGDNPLNFCFPPENDILTINWVDLSPNPPVPGQTLTIT 81 >ref|XP_002629361.1| phosphatidylglycerol/phosphatidylinositol transfer protein [Ajellomyces dermatitidis SLH14081] gi|239587146|gb|EEQ69789.1| phosphatidylglycerol/phosphatidylinositol transfer protein [Ajellomyces dermatitidis SLH14081] Length = 174 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/47 (61%), Positives = 33/47 (70%) Frame = -3 Query: 141 ALVDDALSVPGDNPLQYCAKPEKDILEIQKVDLSPNPPKAGTTLTVT 1 +L + L VPGDNPL +C PE DIL I VDLSPNPP G TLT+T Sbjct: 35 SLAGNELRVPGDNPLNFCFPPENDILTINWVDLSPNPPVPGQTLTIT 81 >ref|XP_002542932.1| phosphatidylglycerol/phosphatidylinositol transfer protein [Uncinocarpus reesii 1704] gi|237903198|gb|EEP77599.1| phosphatidylglycerol/phosphatidylinositol transfer protein [Uncinocarpus reesii 1704] Length = 224 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -3 Query: 135 VDDALSVPGDNPLQYCAKPEKDILEIQKVDLSPNPPKAGTTLTV 4 +++ LSVPGDNPL +C P+ DIL I++VDL PNPP G TLT+ Sbjct: 35 INEDLSVPGDNPLNFCTPPKNDILTIERVDLFPNPPLPGKTLTI 78 >gb|EUC44289.1| hypothetical protein COCMIDRAFT_27352 [Bipolaris oryzae ATCC 44560] Length = 167 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = -3 Query: 144 KALVDDALSVPGDNPLQYCAKPEKDILEIQKVDLSPNPPKAGTTLTV 4 + +V + VPGDNPL +C P DIL I+KVDLSPNPP+ G TL++ Sbjct: 27 QVVVKEEYKVPGDNPLYFCGDPANDILTIEKVDLSPNPPQPGQTLSI 73 >gb|EMD94054.1| hypothetical protein COCHEDRAFT_100154 [Bipolaris maydis C5] gi|477590570|gb|ENI07644.1| hypothetical protein COCC4DRAFT_70242 [Bipolaris maydis ATCC 48331] Length = 167 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = -3 Query: 144 KALVDDALSVPGDNPLQYCAKPEKDILEIQKVDLSPNPPKAGTTLTV 4 + +V + VPGDNPL +C P DIL I+KVDLSPNPP+ G TL++ Sbjct: 27 QVVVKEEYKVPGDNPLYFCGNPADDILTIEKVDLSPNPPQPGQTLSI 73 >gb|EUC29389.1| hypothetical protein COCCADRAFT_40216 [Bipolaris zeicola 26-R-13] gi|578488567|gb|EUN26009.1| hypothetical protein COCVIDRAFT_16840 [Bipolaris victoriae FI3] Length = 167 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = -3 Query: 144 KALVDDALSVPGDNPLQYCAKPEKDILEIQKVDLSPNPPKAGTTLTV 4 + +V + VPGDNPL +C P DIL I+KVDLSPNPP+ G TL++ Sbjct: 27 QVVVKEEYKVPGDNPLYFCGDPADDILTIEKVDLSPNPPQPGQTLSI 73 >gb|ETN47207.1| hypothetical protein HMPREF1541_01398 [Cyphellophora europaea CBS 101466] Length = 170 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/44 (63%), Positives = 31/44 (70%) Frame = -3 Query: 132 DDALSVPGDNPLQYCAKPEKDILEIQKVDLSPNPPKAGTTLTVT 1 DD LSVPG NPL YCA P+ IL I VDL PNPPK G LT++ Sbjct: 33 DDKLSVPGKNPLNYCADPKDYILTIDHVDLDPNPPKPGEKLTIS 76 >gb|EME79368.1| hypothetical protein MYCFIDRAFT_112427, partial [Pseudocercospora fijiensis CIRAD86] Length = 137 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -3 Query: 132 DDALSVPGDNPLQYCAKPEKDILEIQKVDLSPNPPKAGTTLTV 4 +D LSVPG+NPL +C P+ DIL ++ VDL+PNPPKAG+ L V Sbjct: 1 EDPLSVPGENPLLHCEDPKDDILALKSVDLTPNPPKAGSKLEV 43 >gb|EXJ58371.1| hypothetical protein A1O7_05796 [Cladophialophora yegresii CBS 114405] Length = 171 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/50 (60%), Positives = 34/50 (68%), Gaps = 1/50 (2%) Frame = -3 Query: 147 QKALVD-DALSVPGDNPLQYCAKPEKDILEIQKVDLSPNPPKAGTTLTVT 1 Q ALVD D SVPG NPL +CA P+ IL + VDLSPNPP G LT+T Sbjct: 27 QNALVDEDKFSVPGKNPLNFCADPKDYILSVDYVDLSPNPPVPGQKLTIT 76