BLASTX nr result
ID: Akebia25_contig00052214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00052214 (376 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME41532.1| hypothetical protein DOTSEDRAFT_135060 [Dothistro... 66 6e-09 ref|XP_003652037.1| hypothetical protein THITE_2170062 [Thielavi... 65 1e-08 ref|XP_006691959.1| cytochrome c oxidase-like protein [Chaetomiu... 64 2e-08 gb|EME88706.1| hypothetical protein MYCFIDRAFT_87555 [Pseudocerc... 63 4e-08 gb|EHK18998.1| hypothetical protein TRIVIDRAFT_111574 [Trichoder... 62 6e-08 ref|XP_006967154.1| predicted protein [Trichoderma reesei QM6a] ... 62 6e-08 ref|XP_003352489.1| hypothetical protein SMAC_01323 [Sordaria ma... 62 6e-08 ref|XP_965781.1| hypothetical protein NCU00641 [Neurospora crass... 62 6e-08 gb|EMF11059.1| cytochrome c oxidase assembly protein COX16, mito... 62 8e-08 gb|EFZ03977.1| Cytochrome c oxidase assembly protein COX16 [Meta... 62 8e-08 gb|EFY87098.1| Cytochrome c oxidase assembly protein COX16 [Meta... 62 8e-08 gb|EGZ76655.1| cytochrome c oxidase-assembly factor cox-16, mito... 62 1e-07 ref|XP_003659935.1| hypothetical protein MYCTH_2313902 [Myceliop... 62 1e-07 gb|EPE26914.1| hypothetical protein GLAREA_02828 [Glarea lozoyen... 61 2e-07 ref|XP_002842358.1| hypothetical protein [Tuber melanosporum Mel... 61 2e-07 gb|EXJ90448.1| hypothetical protein A1O1_03550 [Capronia coronat... 60 3e-07 gb|EWG45812.1| cytochrome c oxidase assembly protein COX16, mito... 60 3e-07 emb|CCT64161.1| probable COX16-required for the assembly of cyto... 60 3e-07 gb|EGU86643.1| hypothetical protein FOXB_02864 [Fusarium oxyspor... 60 3e-07 gb|EGE05163.1| cytochrome c oxidase-assembly factor cox16 [Trich... 60 3e-07 >gb|EME41532.1| hypothetical protein DOTSEDRAFT_135060 [Dothistroma septosporum NZE10] Length = 115 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 2 DAREEYYKLAAKDLDNWEQKRVERLPGEPDGVL 100 D REEYYKLAAKDLDNWEQKRV+RLPGE DGVL Sbjct: 83 DLREEYYKLAAKDLDNWEQKRVKRLPGEHDGVL 115 >ref|XP_003652037.1| hypothetical protein THITE_2170062 [Thielavia terrestris NRRL 8126] gi|346999299|gb|AEO65701.1| hypothetical protein THITE_2170062 [Thielavia terrestris NRRL 8126] Length = 115 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 2 DAREEYYKLAAKDLDNWEQKRVERLPGEPDGVL 100 D REEYY+LAAKDLDNWEQKRV+RLPGE DGVL Sbjct: 83 DIREEYYRLAAKDLDNWEQKRVKRLPGESDGVL 115 >ref|XP_006691959.1| cytochrome c oxidase-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340975852|gb|EGS22967.1| cytochrome c oxidase-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 115 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 2 DAREEYYKLAAKDLDNWEQKRVERLPGEPDGVL 100 D REEYY+LA KDLDNWEQKRV+RLPGEPDG L Sbjct: 83 DIREEYYRLAYKDLDNWEQKRVKRLPGEPDGTL 115 >gb|EME88706.1| hypothetical protein MYCFIDRAFT_87555 [Pseudocercospora fijiensis CIRAD86] Length = 115 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 2 DAREEYYKLAAKDLDNWEQKRVERLPGEPDGV 97 D +EEYYKLAAKDLDNWEQKRV+RLPGE DGV Sbjct: 83 DLKEEYYKLAAKDLDNWEQKRVKRLPGEHDGV 114 >gb|EHK18998.1| hypothetical protein TRIVIDRAFT_111574 [Trichoderma virens Gv29-8] Length = 115 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 2 DAREEYYKLAAKDLDNWEQKRVERLPGEPDGVL 100 D +EEYY+LA +DLDNWEQKRVERLPGE DG+L Sbjct: 83 DMKEEYYRLAGRDLDNWEQKRVERLPGESDGIL 115 >ref|XP_006967154.1| predicted protein [Trichoderma reesei QM6a] gi|340516542|gb|EGR46790.1| predicted protein [Trichoderma reesei QM6a] gi|572277216|gb|ETS00498.1| hypothetical protein M419DRAFT_131634 [Trichoderma reesei RUT C-30] Length = 115 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 2 DAREEYYKLAAKDLDNWEQKRVERLPGEPDGVL 100 D +EEYY+LA +DLDNWEQKRVERLPGE DG+L Sbjct: 83 DMKEEYYRLAGRDLDNWEQKRVERLPGESDGIL 115 >ref|XP_003352489.1| hypothetical protein SMAC_01323 [Sordaria macrospora k-hell] gi|380094377|emb|CCC07756.1| unnamed protein product [Sordaria macrospora k-hell] Length = 114 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 2 DAREEYYKLAAKDLDNWEQKRVERLPGEPDGVL 100 D REEYY+LAAKDLDNWEQKRVERL GE DG+L Sbjct: 82 DIREEYYRLAAKDLDNWEQKRVERLKGESDGLL 114 >ref|XP_965781.1| hypothetical protein NCU00641 [Neurospora crassa OR74A] gi|74619057|sp|Q7SI11.1|COX16_NEUCR RecName: Full=Cytochrome c oxidase assembly protein cox16, mitochondrial; Flags: Precursor gi|28927594|gb|EAA36545.1| cytochrome c oxidase-assembly factor cox-16 [Neurospora crassa OR74A] gi|336465377|gb|EGO53617.1| hypothetical protein NEUTE1DRAFT_126882 [Neurospora tetrasperma FGSC 2508] Length = 114 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 2 DAREEYYKLAAKDLDNWEQKRVERLPGEPDGVL 100 D REEYY+LAAKDLDNWEQKRVERL GE DG+L Sbjct: 82 DIREEYYRLAAKDLDNWEQKRVERLKGESDGLL 114 >gb|EMF11059.1| cytochrome c oxidase assembly protein COX16, mitochondrial [Sphaerulina musiva SO2202] Length = 114 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +2 Query: 2 DAREEYYKLAAKDLDNWEQKRVERLPGEPDGV 97 D EEYYKLAAKDLDNWEQKRV+RLPGE DGV Sbjct: 82 DLAEEYYKLAAKDLDNWEQKRVKRLPGEHDGV 113 >gb|EFZ03977.1| Cytochrome c oxidase assembly protein COX16 [Metarhizium anisopliae ARSEF 23] gi|594716140|gb|EXU99045.1| cytochrome c oxidase assembly protein COX16 [Metarhizium robertsii] Length = 115 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 2 DAREEYYKLAAKDLDNWEQKRVERLPGEPDGVL 100 D +EEYY+LA +DLDNWEQKRVERLPGE DG+L Sbjct: 83 DMKEEYYRLAGRDLDNWEQKRVERLPGENDGIL 115 >gb|EFY87098.1| Cytochrome c oxidase assembly protein COX16 [Metarhizium acridum CQMa 102] Length = 115 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 2 DAREEYYKLAAKDLDNWEQKRVERLPGEPDGVL 100 D +EEYY+LA +DLDNWEQKRVERLPGE DG+L Sbjct: 83 DMKEEYYRLAGRDLDNWEQKRVERLPGENDGIL 115 >gb|EGZ76655.1| cytochrome c oxidase-assembly factor cox-16, mitochondrial [Neurospora tetrasperma FGSC 2509] Length = 114 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 2 DAREEYYKLAAKDLDNWEQKRVERLPGEPDGVL 100 D REEYY+LAAKD+DNWEQKRVERL GE DG+L Sbjct: 82 DIREEYYRLAAKDIDNWEQKRVERLKGESDGLL 114 >ref|XP_003659935.1| hypothetical protein MYCTH_2313902 [Myceliophthora thermophila ATCC 42464] gi|347007202|gb|AEO54690.1| hypothetical protein MYCTH_2313902 [Myceliophthora thermophila ATCC 42464] Length = 115 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 2 DAREEYYKLAAKDLDNWEQKRVERLPGEPDGVL 100 D REEYY+LAAKDLDNWEQKRV+RL GE DG+L Sbjct: 83 DIREEYYRLAAKDLDNWEQKRVKRLKGESDGIL 115 >gb|EPE26914.1| hypothetical protein GLAREA_02828 [Glarea lozoyensis ATCC 20868] Length = 115 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 2 DAREEYYKLAAKDLDNWEQKRVERLPGEPDGVL 100 D +EEYY+LAAKDLD+WEQKRV+RLPGE DGV+ Sbjct: 83 DMKEEYYRLAAKDLDDWEQKRVKRLPGEHDGVI 115 >ref|XP_002842358.1| hypothetical protein [Tuber melanosporum Mel28] gi|295638623|emb|CAZ86549.1| unnamed protein product [Tuber melanosporum] Length = 115 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 2 DAREEYYKLAAKDLDNWEQKRVERLPGEPDGVL 100 D EEYY+LAAKDLDNWEQKR+ER GEPDG L Sbjct: 83 DLNEEYYRLAAKDLDNWEQKRIERFNGEPDGTL 115 >gb|EXJ90448.1| hypothetical protein A1O1_03550 [Capronia coronata CBS 617.96] Length = 139 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 8 REEYYKLAAKDLDNWEQKRVERLPGEPDGVL 100 R+EYYKL AKDLDNWEQKRVERL GEPDG L Sbjct: 109 RDEYYKLMAKDLDNWEQKRVERLKGEPDGRL 139 >gb|EWG45812.1| cytochrome c oxidase assembly protein COX16, mitochondrial [Fusarium verticillioides 7600] Length = 115 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 2 DAREEYYKLAAKDLDNWEQKRVERLPGEPDGVL 100 D +EEYY+LA KDLD+WEQKRV+RLPGE DGVL Sbjct: 83 DMKEEYYRLAGKDLDDWEQKRVKRLPGENDGVL 115 >emb|CCT64161.1| probable COX16-required for the assembly of cytochrome oxidase [Fusarium fujikuroi IMI 58289] Length = 101 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 2 DAREEYYKLAAKDLDNWEQKRVERLPGEPDGVL 100 D +EEYY+LA KDLD+WEQKRV+RLPGE DGVL Sbjct: 69 DMKEEYYRLAGKDLDDWEQKRVKRLPGENDGVL 101 >gb|EGU86643.1| hypothetical protein FOXB_02864 [Fusarium oxysporum Fo5176] gi|475662484|gb|EMT60280.1| Cytochrome c oxidase assembly protein COX16, mitochondrial [Fusarium oxysporum f. sp. cubense race 4] gi|477513152|gb|ENH65669.1| Cytochrome c oxidase assembly protein COX16, mitochondrial [Fusarium oxysporum f. sp. cubense race 1] gi|587673866|gb|EWY96199.1| cytochrome c oxidase assembly protein COX16, mitochondrial [Fusarium oxysporum FOSC 3-a] gi|587695380|gb|EWZ41985.1| cytochrome c oxidase assembly protein COX16, mitochondrial [Fusarium oxysporum Fo47] gi|587729579|gb|EXA00917.1| cytochrome c oxidase assembly protein COX16, mitochondrial [Fusarium oxysporum f. sp. lycopersici MN25] gi|587750025|gb|EXA47741.1| cytochrome c oxidase assembly protein COX16, mitochondrial [Fusarium oxysporum f. sp. pisi HDV247] gi|587750026|gb|EXA47742.1| cytochrome c oxidase assembly protein COX16, mitochondrial [Fusarium oxysporum f. sp. pisi HDV247] gi|590029727|gb|EXK31585.1| cytochrome c oxidase assembly protein COX16, mitochondrial [Fusarium oxysporum f. sp. melonis 26406] gi|590052754|gb|EXK80278.1| cytochrome c oxidase assembly protein COX16, mitochondrial [Fusarium oxysporum f. sp. raphani 54005] gi|591424463|gb|EXL59600.1| cytochrome c oxidase assembly protein COX16, mitochondrial [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591455226|gb|EXL87466.1| cytochrome c oxidase assembly protein COX16, mitochondrial [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591464235|gb|EXL95701.1| cytochrome c oxidase assembly protein COX16, mitochondrial [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591464236|gb|EXL95702.1| cytochrome c oxidase assembly protein COX16, mitochondrial [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591495718|gb|EXM25234.1| cytochrome c oxidase assembly protein COX16, mitochondrial [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 115 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 2 DAREEYYKLAAKDLDNWEQKRVERLPGEPDGVL 100 D +EEYY+LA KDLD+WEQKRV+RLPGE DGVL Sbjct: 83 DMKEEYYRLAGKDLDDWEQKRVKRLPGENDGVL 115 >gb|EGE05163.1| cytochrome c oxidase-assembly factor cox16 [Trichophyton equinum CBS 127.97] Length = 90 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 2 DAREEYYKLAAKDLDNWEQKRVERLPGEPDG 94 D REEYYKL AKDLDNWEQKRV+R GEPDG Sbjct: 57 DEREEYYKLMAKDLDNWEQKRVQRFKGEPDG 87