BLASTX nr result
ID: Akebia25_contig00026975
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00026975 (387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273029.1| PREDICTED: tryptophanyl-tRNA synthetase [Vit... 67 2e-09 emb|CAN69374.1| hypothetical protein VITISV_008200 [Vitis vinifera] 67 2e-09 ref|XP_006476009.1| PREDICTED: tryptophan--tRNA ligase, mitochon... 66 4e-09 ref|XP_006476008.1| PREDICTED: tryptophan--tRNA ligase, mitochon... 66 4e-09 ref|XP_006476007.1| PREDICTED: tryptophan--tRNA ligase, mitochon... 66 4e-09 ref|XP_006450725.1| hypothetical protein CICLE_v10010686mg [Citr... 66 4e-09 ref|XP_002516528.1| tryptophanyl-tRNA synthetase, putative [Rici... 65 8e-09 ref|XP_004253104.1| PREDICTED: tryptophan--tRNA ligase-like [Sol... 65 1e-08 ref|XP_004291161.1| PREDICTED: tryptophan--tRNA ligase-like [Fra... 64 2e-08 ref|XP_006342515.1| PREDICTED: tryptophan--tRNA ligase, mitochon... 64 2e-08 gb|ACN36389.1| unknown [Zea mays] gi|414880564|tpg|DAA57695.1| T... 64 2e-08 ref|NP_001140250.1| uncharacterized protein LOC100272291 [Zea ma... 64 2e-08 gb|EXB60289.1| Tryptophan--tRNA ligase [Morus notabilis] 64 3e-08 ref|XP_006853682.1| hypothetical protein AMTR_s00056p00130690 [A... 64 3e-08 ref|XP_003527850.1| PREDICTED: tryptophan--tRNA ligase, mitochon... 63 4e-08 ref|XP_007012172.1| Nucleotidylyl transferase superfamily protei... 62 6e-08 ref|XP_004501095.1| PREDICTED: tryptophan--tRNA ligase-like [Cic... 62 8e-08 ref|XP_007221585.1| hypothetical protein PRUPE_ppa025950mg, part... 62 8e-08 ref|XP_006578242.1| PREDICTED: tryptophan--tRNA ligase, mitochon... 61 1e-07 ref|XP_006578241.1| PREDICTED: tryptophan--tRNA ligase, mitochon... 61 1e-07 >ref|XP_002273029.1| PREDICTED: tryptophanyl-tRNA synthetase [Vitis vinifera] gi|296081565|emb|CBI20570.3| unnamed protein product [Vitis vinifera] Length = 416 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -3 Query: 385 VRYKDIISDSTYLDRVLMEGAIRAVDIVDATLNNVYQAMGFFQ 257 VRY++I+SDS YLDR+L EGA +A DI DATLNNVYQAMGF + Sbjct: 373 VRYEEIMSDSAYLDRLLAEGATKAADIADATLNNVYQAMGFLR 415 >emb|CAN69374.1| hypothetical protein VITISV_008200 [Vitis vinifera] Length = 137 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -3 Query: 385 VRYKDIISDSTYLDRVLMEGAIRAVDIVDATLNNVYQAMGFFQ 257 VRY++I+SDS YLDR+L EGA +A DI DATLNNVYQAMGF + Sbjct: 94 VRYEEIMSDSAYLDRLLAEGATKAADIADATLNNVYQAMGFLR 136 >ref|XP_006476009.1| PREDICTED: tryptophan--tRNA ligase, mitochondrial-like isoform X3 [Citrus sinensis] Length = 419 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -3 Query: 385 VRYKDIISDSTYLDRVLMEGAIRAVDIVDATLNNVYQAMGFFQ 257 VRY++I+SDS YLD+VL +GA +A DI DATLNNVYQAMGF + Sbjct: 376 VRYEEIMSDSAYLDKVLADGAAKAADIADATLNNVYQAMGFLR 418 >ref|XP_006476008.1| PREDICTED: tryptophan--tRNA ligase, mitochondrial-like isoform X2 [Citrus sinensis] Length = 424 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -3 Query: 385 VRYKDIISDSTYLDRVLMEGAIRAVDIVDATLNNVYQAMGFFQ 257 VRY++I+SDS YLD+VL +GA +A DI DATLNNVYQAMGF + Sbjct: 381 VRYEEIMSDSAYLDKVLADGAAKAADIADATLNNVYQAMGFLR 423 >ref|XP_006476007.1| PREDICTED: tryptophan--tRNA ligase, mitochondrial-like isoform X1 [Citrus sinensis] Length = 427 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -3 Query: 385 VRYKDIISDSTYLDRVLMEGAIRAVDIVDATLNNVYQAMGFFQ 257 VRY++I+SDS YLD+VL +GA +A DI DATLNNVYQAMGF + Sbjct: 384 VRYEEIMSDSAYLDKVLADGAAKAADIADATLNNVYQAMGFLR 426 >ref|XP_006450725.1| hypothetical protein CICLE_v10010686mg [Citrus clementina] gi|557553951|gb|ESR63965.1| hypothetical protein CICLE_v10010686mg [Citrus clementina] Length = 419 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -3 Query: 385 VRYKDIISDSTYLDRVLMEGAIRAVDIVDATLNNVYQAMGFFQ 257 VRY++I+SDS YLD+VL +GA +A DI DATLNNVYQAMGF + Sbjct: 376 VRYEEIMSDSAYLDKVLADGAAKAADIADATLNNVYQAMGFLR 418 >ref|XP_002516528.1| tryptophanyl-tRNA synthetase, putative [Ricinus communis] gi|223544348|gb|EEF45869.1| tryptophanyl-tRNA synthetase, putative [Ricinus communis] Length = 412 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -3 Query: 385 VRYKDIISDSTYLDRVLMEGAIRAVDIVDATLNNVYQAMGFFQ 257 V+Y++IISDS YLDRVL EGA A +I DATLNNVYQAMGF + Sbjct: 369 VQYEEIISDSAYLDRVLEEGAANAAEIADATLNNVYQAMGFLR 411 >ref|XP_004253104.1| PREDICTED: tryptophan--tRNA ligase-like [Solanum lycopersicum] Length = 412 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 385 VRYKDIISDSTYLDRVLMEGAIRAVDIVDATLNNVYQAMGFFQ 257 VRY++IISDS+YLD VL EGA +A DI D T+NNVYQAMGF + Sbjct: 369 VRYEEIISDSSYLDEVLAEGARKAADIADVTVNNVYQAMGFLK 411 >ref|XP_004291161.1| PREDICTED: tryptophan--tRNA ligase-like [Fragaria vesca subsp. vesca] Length = 418 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 385 VRYKDIISDSTYLDRVLMEGAIRAVDIVDATLNNVYQAMGFFQ 257 VRY++IISDS YLD +L EGA +A DI D TLNNVYQAMGF + Sbjct: 375 VRYEEIISDSAYLDGILAEGATKASDIADTTLNNVYQAMGFLR 417 >ref|XP_006342515.1| PREDICTED: tryptophan--tRNA ligase, mitochondrial-like [Solanum tuberosum] Length = 412 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 385 VRYKDIISDSTYLDRVLMEGAIRAVDIVDATLNNVYQAMGFFQ 257 VRY++IISDS+YLD VL EGA +A DI D T+NNVYQAMGF + Sbjct: 369 VRYEEIISDSSYLDGVLAEGARKAADIADVTVNNVYQAMGFLK 411 >gb|ACN36389.1| unknown [Zea mays] gi|414880564|tpg|DAA57695.1| TPA: hypothetical protein ZEAMMB73_474699 [Zea mays] Length = 212 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 385 VRYKDIISDSTYLDRVLMEGAIRAVDIVDATLNNVYQAMGFFQ 257 VRY++I+SD YLD VL+EGA++A +I D TLNNVYQAMGF + Sbjct: 169 VRYEEIMSDPAYLDNVLLEGAVKAAEIADITLNNVYQAMGFLR 211 >ref|NP_001140250.1| uncharacterized protein LOC100272291 [Zea mays] gi|194698694|gb|ACF83431.1| unknown [Zea mays] gi|414880562|tpg|DAA57693.1| TPA: hypothetical protein ZEAMMB73_474699 [Zea mays] Length = 405 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 385 VRYKDIISDSTYLDRVLMEGAIRAVDIVDATLNNVYQAMGFFQ 257 VRY++I+SD YLD VL+EGA++A +I D TLNNVYQAMGF + Sbjct: 362 VRYEEIMSDPAYLDNVLLEGAVKAAEIADITLNNVYQAMGFLR 404 >gb|EXB60289.1| Tryptophan--tRNA ligase [Morus notabilis] Length = 404 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -3 Query: 385 VRYKDIISDSTYLDRVLMEGAIRAVDIVDATLNNVYQAMGFFQ 257 VRY++I SDS YLDR+L EGA +A DI D+TL+NVYQAMGF + Sbjct: 361 VRYEEITSDSAYLDRILAEGAAKASDIADSTLDNVYQAMGFLR 403 >ref|XP_006853682.1| hypothetical protein AMTR_s00056p00130690 [Amborella trichopoda] gi|548857343|gb|ERN15149.1| hypothetical protein AMTR_s00056p00130690 [Amborella trichopoda] Length = 406 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -3 Query: 382 RYKDIISDSTYLDRVLMEGAIRAVDIVDATLNNVYQAMGFFQ 257 RY+DIISDS YLD VL EGA +A I DATL+NVYQAMGF + Sbjct: 364 RYEDIISDSAYLDNVLAEGATKAASIADATLHNVYQAMGFLR 405 >ref|XP_003527850.1| PREDICTED: tryptophan--tRNA ligase, mitochondrial-like [Glycine max] Length = 393 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -3 Query: 385 VRYKDIISDSTYLDRVLMEGAIRAVDIVDATLNNVYQAMGFFQ 257 VRY++I+SDS YLD VL +GA A DI D+TLNN+YQAMGFF+ Sbjct: 349 VRYEEIMSDSGYLDGVLAQGARNAADIADSTLNNIYQAMGFFK 391 >ref|XP_007012172.1| Nucleotidylyl transferase superfamily protein isoform 3 [Theobroma cacao] gi|508782535|gb|EOY29791.1| Nucleotidylyl transferase superfamily protein isoform 3 [Theobroma cacao] Length = 416 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = -3 Query: 385 VRYKDIISDSTYLDRVLMEGAIRAVDIVDATLNNVYQAMGF 263 VRY+DIISD YLD VL EGA +A I DATLNNVYQAMGF Sbjct: 373 VRYEDIISDPAYLDGVLAEGAEKAAAIADATLNNVYQAMGF 413 >ref|XP_004501095.1| PREDICTED: tryptophan--tRNA ligase-like [Cicer arietinum] Length = 395 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -3 Query: 385 VRYKDIISDSTYLDRVLMEGAIRAVDIVDATLNNVYQAMGFFQ 257 VRY++++SDS YLD+VL EGA A DI DATL+NVYQAMGF + Sbjct: 351 VRYEELMSDSGYLDKVLEEGARNAADIADATLHNVYQAMGFLR 393 >ref|XP_007221585.1| hypothetical protein PRUPE_ppa025950mg, partial [Prunus persica] gi|462418521|gb|EMJ22784.1| hypothetical protein PRUPE_ppa025950mg, partial [Prunus persica] Length = 341 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 385 VRYKDIISDSTYLDRVLMEGAIRAVDIVDATLNNVYQAMGFFQ 257 VRY++IISDS YLD +L EGA +A I DATL+NVYQAMGF + Sbjct: 298 VRYEEIISDSAYLDGILAEGATKAAGIADATLHNVYQAMGFLR 340 >ref|XP_006578242.1| PREDICTED: tryptophan--tRNA ligase, mitochondrial-like isoform X3 [Glycine max] Length = 395 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 385 VRYKDIISDSTYLDRVLMEGAIRAVDIVDATLNNVYQAMGFFQ 257 VRY++I+SDS YLD VL +GA A DI D+TLNNVYQAMGF + Sbjct: 346 VRYEEIMSDSGYLDGVLAQGARNAADIADSTLNNVYQAMGFLK 388 >ref|XP_006578241.1| PREDICTED: tryptophan--tRNA ligase, mitochondrial-like isoform X2 [Glycine max] Length = 399 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 385 VRYKDIISDSTYLDRVLMEGAIRAVDIVDATLNNVYQAMGFFQ 257 VRY++I+SDS YLD VL +GA A DI D+TLNNVYQAMGF + Sbjct: 350 VRYEEIMSDSGYLDGVLAQGARNAADIADSTLNNVYQAMGFLK 392