BLASTX nr result
ID: Akebia25_contig00026272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00026272 (232 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS70341.1| hypothetical protein M569_04419, partial [Genlise... 78 1e-12 ref|NP_180353.1| UDP-D-apiose/UDP-D-xylose synthase 1 [Arabidops... 78 1e-12 ref|XP_002879132.1| UDP-D-apiose/UDP-D-xylose synthase 1 [Arabid... 78 1e-12 gb|ACJ84436.1| unknown [Medicago truncatula] 78 1e-12 gb|EYU36994.1| hypothetical protein MIMGU_mgv1a008022mg [Mimulus... 77 2e-12 gb|EYU36110.1| hypothetical protein MIMGU_mgv1a008026mg [Mimulus... 77 2e-12 gb|EXB81613.1| Bifunctional polymyxin resistance protein ArnA [M... 77 2e-12 ref|XP_006645335.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthas... 77 2e-12 ref|XP_006592299.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthas... 77 2e-12 ref|XP_006484961.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthas... 77 2e-12 ref|XP_006349067.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthas... 77 2e-12 ref|XP_006347220.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthas... 77 2e-12 ref|XP_007150121.1| hypothetical protein PHAVU_005G128500g [Phas... 77 2e-12 ref|XP_007132367.1| hypothetical protein PHAVU_011G088900g [Phas... 77 2e-12 ref|XP_006424364.1| hypothetical protein CICLE_v10028621mg [Citr... 77 2e-12 ref|XP_006409801.1| hypothetical protein EUTSA_v10016776mg [Eutr... 77 2e-12 ref|XP_006409800.1| hypothetical protein EUTSA_v10016776mg [Eutr... 77 2e-12 ref|XP_006409799.1| hypothetical protein EUTSA_v10016776mg [Eutr... 77 2e-12 ref|XP_006417716.1| hypothetical protein EUTSA_v10007880mg [Eutr... 77 2e-12 ref|XP_002312885.2| UDP-D-APIOSE/UDP-D-XYLOSE SYNTHASE 1 family ... 77 2e-12 >gb|EPS70341.1| hypothetical protein M569_04419, partial [Genlisea aurea] Length = 244 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -1 Query: 232 MINLAAICTPADYNTRPLDTIYSNFIDALPLVKYCSE 122 +INLAAICTPADYNTRPLDTIYSNFIDALP+VKYCSE Sbjct: 91 VINLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSE 127 >ref|NP_180353.1| UDP-D-apiose/UDP-D-xylose synthase 1 [Arabidopsis thaliana] gi|75315930|sp|Q9ZUY6.1|AXS1_ARATH RecName: Full=UDP-D-apiose/UDP-D-xylose synthase 1 gi|13605497|gb|AAK32742.1|AF361574_1 At2g27860/F15K20.4 [Arabidopsis thaliana] gi|3860247|gb|AAC73015.1| putative dTDP-glucose 4-6-dehydratase [Arabidopsis thaliana] gi|21555529|gb|AAM63878.1| putative dTDP-glucose 4-6-dehydratase [Arabidopsis thaliana] gi|24111293|gb|AAN46770.1| At2g27860/F15K20.4 [Arabidopsis thaliana] gi|38231566|gb|AAR14687.1| UDP-D-apiose/UDP-D-xylose synthase [Arabidopsis thaliana] gi|52354277|gb|AAU44459.1| hypothetical protein AT2G27860 [Arabidopsis thaliana] gi|60547725|gb|AAX23826.1| hypothetical protein At2g27860 [Arabidopsis thaliana] gi|330252960|gb|AEC08054.1| UDP-D-apiose/UDP-D-xylose synthase 1 [Arabidopsis thaliana] Length = 389 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -1 Query: 232 MINLAAICTPADYNTRPLDTIYSNFIDALPLVKYCSE 122 +INLAAICTPADYNTRPLDTIYSNFIDALP+VKYCSE Sbjct: 93 IINLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSE 129 >ref|XP_002879132.1| UDP-D-apiose/UDP-D-xylose synthase 1 [Arabidopsis lyrata subsp. lyrata] gi|297324971|gb|EFH55391.1| UDP-D-apiose/UDP-D-xylose synthase 1 [Arabidopsis lyrata subsp. lyrata] Length = 389 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -1 Query: 232 MINLAAICTPADYNTRPLDTIYSNFIDALPLVKYCSE 122 +INLAAICTPADYNTRPLDTIYSNFIDALP+VKYCSE Sbjct: 93 VINLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSE 129 >gb|ACJ84436.1| unknown [Medicago truncatula] Length = 390 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -1 Query: 232 MINLAAICTPADYNTRPLDTIYSNFIDALPLVKYCSE 122 +INLAAICTPADYNTRPLDTIYSNFIDALP+VKYCSE Sbjct: 94 VINLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSE 130 >gb|EYU36994.1| hypothetical protein MIMGU_mgv1a008022mg [Mimulus guttatus] Length = 387 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 229 INLAAICTPADYNTRPLDTIYSNFIDALPLVKYCSE 122 INLAAICTPADYNTRPLDTIYSNFIDALP+VKYCSE Sbjct: 92 INLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSE 127 >gb|EYU36110.1| hypothetical protein MIMGU_mgv1a008026mg [Mimulus guttatus] Length = 387 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 229 INLAAICTPADYNTRPLDTIYSNFIDALPLVKYCSE 122 INLAAICTPADYNTRPLDTIYSNFIDALP+VKYCSE Sbjct: 92 INLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSE 127 >gb|EXB81613.1| Bifunctional polymyxin resistance protein ArnA [Morus notabilis] Length = 389 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 229 INLAAICTPADYNTRPLDTIYSNFIDALPLVKYCSE 122 INLAAICTPADYNTRPLDTIYSNFIDALP+VKYCSE Sbjct: 93 INLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSE 128 >ref|XP_006645335.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthase-like, partial [Oryza brachyantha] Length = 393 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 229 INLAAICTPADYNTRPLDTIYSNFIDALPLVKYCSE 122 INLAAICTPADYNTRPLDTIYSNFIDALP+VKYCSE Sbjct: 97 INLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSE 132 >ref|XP_006592299.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthase 2-like [Glycine max] Length = 385 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 229 INLAAICTPADYNTRPLDTIYSNFIDALPLVKYCSE 122 INLAAICTPADYNTRPLDTIYSNFIDALP+VKYCSE Sbjct: 90 INLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSE 125 >ref|XP_006484961.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthase 2-like [Citrus sinensis] Length = 390 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 229 INLAAICTPADYNTRPLDTIYSNFIDALPLVKYCSE 122 INLAAICTPADYNTRPLDTIYSNFIDALP+VKYCSE Sbjct: 94 INLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSE 129 >ref|XP_006349067.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthase 2-like [Solanum tuberosum] Length = 386 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 229 INLAAICTPADYNTRPLDTIYSNFIDALPLVKYCSE 122 INLAAICTPADYNTRPLDTIYSNFIDALP+VKYCSE Sbjct: 91 INLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSE 126 >ref|XP_006347220.1| PREDICTED: UDP-D-apiose/UDP-D-xylose synthase 2-like [Solanum tuberosum] Length = 386 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 229 INLAAICTPADYNTRPLDTIYSNFIDALPLVKYCSE 122 INLAAICTPADYNTRPLDTIYSNFIDALP+VKYCSE Sbjct: 91 INLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSE 126 >ref|XP_007150121.1| hypothetical protein PHAVU_005G128500g [Phaseolus vulgaris] gi|561023385|gb|ESW22115.1| hypothetical protein PHAVU_005G128500g [Phaseolus vulgaris] Length = 387 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 229 INLAAICTPADYNTRPLDTIYSNFIDALPLVKYCSE 122 INLAAICTPADYNTRPLDTIYSNFIDALP+VKYCSE Sbjct: 92 INLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSE 127 >ref|XP_007132367.1| hypothetical protein PHAVU_011G088900g [Phaseolus vulgaris] gi|561005367|gb|ESW04361.1| hypothetical protein PHAVU_011G088900g [Phaseolus vulgaris] Length = 301 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 229 INLAAICTPADYNTRPLDTIYSNFIDALPLVKYCSE 122 INLAAICTPADYNTRPLDTIYSNFIDALP+VKYCSE Sbjct: 6 INLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSE 41 >ref|XP_006424364.1| hypothetical protein CICLE_v10028621mg [Citrus clementina] gi|557526298|gb|ESR37604.1| hypothetical protein CICLE_v10028621mg [Citrus clementina] Length = 390 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 229 INLAAICTPADYNTRPLDTIYSNFIDALPLVKYCSE 122 INLAAICTPADYNTRPLDTIYSNFIDALP+VKYCSE Sbjct: 94 INLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSE 129 >ref|XP_006409801.1| hypothetical protein EUTSA_v10016776mg [Eutrema salsugineum] gi|557110970|gb|ESQ51254.1| hypothetical protein EUTSA_v10016776mg [Eutrema salsugineum] Length = 389 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 229 INLAAICTPADYNTRPLDTIYSNFIDALPLVKYCSE 122 INLAAICTPADYNTRPLDTIYSNFIDALP+VKYCSE Sbjct: 94 INLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSE 129 >ref|XP_006409800.1| hypothetical protein EUTSA_v10016776mg [Eutrema salsugineum] gi|557110969|gb|ESQ51253.1| hypothetical protein EUTSA_v10016776mg [Eutrema salsugineum] Length = 302 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 229 INLAAICTPADYNTRPLDTIYSNFIDALPLVKYCSE 122 INLAAICTPADYNTRPLDTIYSNFIDALP+VKYCSE Sbjct: 94 INLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSE 129 >ref|XP_006409799.1| hypothetical protein EUTSA_v10016776mg [Eutrema salsugineum] gi|557110968|gb|ESQ51252.1| hypothetical protein EUTSA_v10016776mg [Eutrema salsugineum] Length = 325 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 229 INLAAICTPADYNTRPLDTIYSNFIDALPLVKYCSE 122 INLAAICTPADYNTRPLDTIYSNFIDALP+VKYCSE Sbjct: 30 INLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSE 65 >ref|XP_006417716.1| hypothetical protein EUTSA_v10007880mg [Eutrema salsugineum] gi|557095487|gb|ESQ36069.1| hypothetical protein EUTSA_v10007880mg [Eutrema salsugineum] Length = 389 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 229 INLAAICTPADYNTRPLDTIYSNFIDALPLVKYCSE 122 INLAAICTPADYNTRPLDTIYSNFIDALP+VKYCSE Sbjct: 94 INLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSE 129 >ref|XP_002312885.2| UDP-D-APIOSE/UDP-D-XYLOSE SYNTHASE 1 family protein [Populus trichocarpa] gi|550331778|gb|EEE86840.2| UDP-D-APIOSE/UDP-D-XYLOSE SYNTHASE 1 family protein [Populus trichocarpa] Length = 389 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 229 INLAAICTPADYNTRPLDTIYSNFIDALPLVKYCSE 122 INLAAICTPADYNTRPLDTIYSNFIDALP+VKYCSE Sbjct: 94 INLAAICTPADYNTRPLDTIYSNFIDALPVVKYCSE 129