BLASTX nr result
ID: Akebia25_contig00025800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00025800 (271 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15581.3| unnamed protein product [Vitis vinifera] 77 3e-12 emb|CAN69474.1| hypothetical protein VITISV_014375 [Vitis vinifera] 77 3e-12 ref|XP_002278684.1| PREDICTED: uncharacterized protein LOC100262... 75 7e-12 gb|EXB80320.1| Protection of telomeres protein 1 [Morus notabilis] 73 5e-11 gb|ACH57392.1| putative single-strand telomere binding protein [... 72 1e-10 ref|XP_006490784.1| PREDICTED: protection of telomeres protein 1... 69 7e-10 ref|XP_006451607.1| hypothetical protein CICLE_v10008209mg [Citr... 69 7e-10 ref|XP_006451606.1| hypothetical protein CICLE_v10008209mg [Citr... 69 7e-10 ref|XP_006451605.1| hypothetical protein CICLE_v10008209mg [Citr... 69 7e-10 gb|ACJ49159.1| protection of telomeres 1 protein [Populus tricho... 69 7e-10 ref|XP_002530479.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 ref|NP_178592.3| protection of telomeres protein 1a [Arabidopsis... 67 3e-09 gb|AAS59561.1| Pot1-like protein [Arabidopsis thaliana] 67 3e-09 gb|ACJ49158.1| protection of telomeres 1 protein [Lactuca sativa] 67 3e-09 ref|XP_002883684.1| DNA binding protein [Arabidopsis lyrata subs... 66 4e-09 gb|ACJ49155.1| protection of telomeres 1a protein [Arabidopsis l... 66 4e-09 ref|XP_006397255.1| hypothetical protein EUTSA_v10028628mg [Eutr... 66 6e-09 gb|AFQ21591.2| protection of telomeres 1a, partial [Aethionema s... 66 6e-09 gb|EEC77443.1| hypothetical protein OsI_16245 [Oryza sativa Indi... 65 8e-09 dbj|BAG94153.1| unnamed protein product [Oryza sativa Japonica G... 65 8e-09 >emb|CBI15581.3| unnamed protein product [Vitis vinifera] Length = 491 Score = 77.0 bits (188), Expect = 3e-12 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 260 NAPRNPPWVQCCIKSYYVDKGDPWGSRNYQIFGTRLV 150 NAPRNPPWVQCCIKSYY+ KGD WGSR Y+IFGTRLV Sbjct: 454 NAPRNPPWVQCCIKSYYLVKGDVWGSRRYRIFGTRLV 490 >emb|CAN69474.1| hypothetical protein VITISV_014375 [Vitis vinifera] Length = 1383 Score = 77.0 bits (188), Expect = 3e-12 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 260 NAPRNPPWVQCCIKSYYVDKGDPWGSRNYQIFGTRLV 150 NAPRNPPWVQCCIKSYY+ KGD WGSR Y+IFGTRLV Sbjct: 1346 NAPRNPPWVQCCIKSYYLVKGDVWGSRTYRIFGTRLV 1382 >ref|XP_002278684.1| PREDICTED: uncharacterized protein LOC100262869 [Vitis vinifera] Length = 487 Score = 75.5 bits (184), Expect = 7e-12 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -3 Query: 260 NAPRNPPWVQCCIKSYYVDKGDPWGSRNYQIFGTRL 153 NAPRNPPWVQCCIKSYY+ KGD WGSR Y+IFGTRL Sbjct: 426 NAPRNPPWVQCCIKSYYLVKGDVWGSRRYRIFGTRL 461 >gb|EXB80320.1| Protection of telomeres protein 1 [Morus notabilis] Length = 466 Score = 72.8 bits (177), Expect = 5e-11 Identities = 27/38 (71%), Positives = 36/38 (94%) Frame = -3 Query: 263 ENAPRNPPWVQCCIKSYYVDKGDPWGSRNYQIFGTRLV 150 ++APRNPPWVQCC+KSYY+DK D WG+R+Y+IFGT++V Sbjct: 427 KDAPRNPPWVQCCLKSYYLDKSDVWGTRHYRIFGTKVV 464 >gb|ACH57392.1| putative single-strand telomere binding protein [Carica papaya] Length = 463 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -3 Query: 263 ENAPRNPPWVQCCIKSYYVDKGDPWGSRNYQIFGTRLVA 147 ENAPRNPPWVQ C+KSYY+DK PW +RNY+IFGT++V+ Sbjct: 425 ENAPRNPPWVQICLKSYYLDKQKPWETRNYRIFGTQIVS 463 >ref|XP_006490784.1| PREDICTED: protection of telomeres protein 1b-like isoform X5 [Citrus sinensis] Length = 355 Score = 68.9 bits (167), Expect = 7e-10 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -3 Query: 263 ENAPRNPPWVQCCIKSYYVDKGDPWGSRNYQIFGTRL 153 ++APRNPPWVQCC+KSYY+D+ D WGSR Y+IF T++ Sbjct: 317 KDAPRNPPWVQCCLKSYYIDRNDIWGSRQYRIFDTKI 353 >ref|XP_006451607.1| hypothetical protein CICLE_v10008209mg [Citrus clementina] gi|568875394|ref|XP_006490783.1| PREDICTED: protection of telomeres protein 1b-like isoform X4 [Citrus sinensis] gi|557554833|gb|ESR64847.1| hypothetical protein CICLE_v10008209mg [Citrus clementina] Length = 376 Score = 68.9 bits (167), Expect = 7e-10 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -3 Query: 263 ENAPRNPPWVQCCIKSYYVDKGDPWGSRNYQIFGTRL 153 ++APRNPPWVQCC+KSYY+D+ D WGSR Y+IF T++ Sbjct: 338 KDAPRNPPWVQCCLKSYYIDRNDIWGSRQYRIFDTKI 374 >ref|XP_006451606.1| hypothetical protein CICLE_v10008209mg [Citrus clementina] gi|568875388|ref|XP_006490780.1| PREDICTED: protection of telomeres protein 1b-like isoform X1 [Citrus sinensis] gi|557554832|gb|ESR64846.1| hypothetical protein CICLE_v10008209mg [Citrus clementina] Length = 464 Score = 68.9 bits (167), Expect = 7e-10 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -3 Query: 263 ENAPRNPPWVQCCIKSYYVDKGDPWGSRNYQIFGTRL 153 ++APRNPPWVQCC+KSYY+D+ D WGSR Y+IF T++ Sbjct: 426 KDAPRNPPWVQCCLKSYYIDRNDIWGSRQYRIFDTKI 462 >ref|XP_006451605.1| hypothetical protein CICLE_v10008209mg [Citrus clementina] gi|568875390|ref|XP_006490781.1| PREDICTED: protection of telomeres protein 1b-like isoform X2 [Citrus sinensis] gi|557554831|gb|ESR64845.1| hypothetical protein CICLE_v10008209mg [Citrus clementina] Length = 429 Score = 68.9 bits (167), Expect = 7e-10 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -3 Query: 263 ENAPRNPPWVQCCIKSYYVDKGDPWGSRNYQIFGTRL 153 ++APRNPPWVQCC+KSYY+D+ D WGSR Y+IF T++ Sbjct: 391 KDAPRNPPWVQCCLKSYYIDRNDIWGSRQYRIFDTKI 427 >gb|ACJ49159.1| protection of telomeres 1 protein [Populus trichocarpa] Length = 462 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -3 Query: 257 APRNPPWVQCCIKSYYVDKGDPWGSRNYQIFGTRL 153 A RNPPWVQCC+KSYY+DK D WGSR Y+IFGT+L Sbjct: 426 ASRNPPWVQCCLKSYYLDKNDIWGSRQYRIFGTKL 460 >ref|XP_002530479.1| conserved hypothetical protein [Ricinus communis] gi|223529976|gb|EEF31902.1| conserved hypothetical protein [Ricinus communis] Length = 449 Score = 67.4 bits (163), Expect = 2e-09 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = -3 Query: 263 ENAPRNPPWVQCCIKSYYVDKGDPWGSRNYQIFGTRLV 150 E APRNPPWVQCC+KSYY+++ + WGSR+++IFGT+ V Sbjct: 411 EGAPRNPPWVQCCLKSYYLNRNNTWGSRHFRIFGTKHV 448 >ref|NP_178592.3| protection of telomeres protein 1a [Arabidopsis thaliana] gi|186499448|ref|NP_001118270.1| protection of telomeres protein 1a [Arabidopsis thaliana] gi|186499452|ref|NP_001118271.1| protection of telomeres protein 1a [Arabidopsis thaliana] gi|75283548|sp|Q56Y52.1|POT1A_ARATH RecName: Full=Protection of telomeres protein 1a; Short=AtPOT1a; AltName: Full=Protection of telomeres protein 1 gi|62320290|dbj|BAD94597.1| hypothetical protein [Arabidopsis thaliana] gi|66796155|dbj|BAD99146.1| Telomere end binding protein-like protein [Arabidopsis thaliana] gi|66986424|gb|AAX78213.2| protection of telomeres 1 protein [Arabidopsis thaliana] gi|330250810|gb|AEC05904.1| protection of telomeres protein 1a [Arabidopsis thaliana] gi|330250811|gb|AEC05905.1| protection of telomeres protein 1a [Arabidopsis thaliana] gi|330250812|gb|AEC05906.1| protection of telomeres protein 1a [Arabidopsis thaliana] Length = 467 Score = 67.0 bits (162), Expect = 3e-09 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 257 APRNPPWVQCCIKSYYVDKGDPWGSRNYQIFGTRLV 150 APRNPPW++CCI SYY +K DPW +R Y+IFGTRL+ Sbjct: 431 APRNPPWIECCILSYYTNKADPWNTRLYRIFGTRLL 466 >gb|AAS59561.1| Pot1-like protein [Arabidopsis thaliana] Length = 467 Score = 67.0 bits (162), Expect = 3e-09 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 257 APRNPPWVQCCIKSYYVDKGDPWGSRNYQIFGTRLV 150 APRNPPW++CCI SYY +K DPW +R Y+IFGTRL+ Sbjct: 431 APRNPPWIECCILSYYTNKADPWNTRLYRIFGTRLL 466 >gb|ACJ49158.1| protection of telomeres 1 protein [Lactuca sativa] Length = 466 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/42 (66%), Positives = 32/42 (76%), Gaps = 2/42 (4%) Frame = -3 Query: 269 IDEN--APRNPPWVQCCIKSYYVDKGDPWGSRNYQIFGTRLV 150 IDEN RNPPW+ CC+KSYYVDK D WGSR Y IF T+L+ Sbjct: 417 IDENNGKARNPPWIDCCLKSYYVDKNDMWGSRRYGIFDTKLI 458 >ref|XP_002883684.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata] gi|297329524|gb|EFH59943.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata] Length = 467 Score = 66.2 bits (160), Expect = 4e-09 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 257 APRNPPWVQCCIKSYYVDKGDPWGSRNYQIFGTRLV 150 APRNPPW++CCI SYY +K DPW +R Y+IFGTRL+ Sbjct: 431 APRNPPWIECCILSYYTNKADPWKTRLYRIFGTRLL 466 >gb|ACJ49155.1| protection of telomeres 1a protein [Arabidopsis lyrata] Length = 467 Score = 66.2 bits (160), Expect = 4e-09 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 257 APRNPPWVQCCIKSYYVDKGDPWGSRNYQIFGTRLV 150 APRNPPW++CCI SYY +K DPW +R Y+IFGTRL+ Sbjct: 431 APRNPPWIECCILSYYTNKADPWKTRLYRIFGTRLL 466 >ref|XP_006397255.1| hypothetical protein EUTSA_v10028628mg [Eutrema salsugineum] gi|557098272|gb|ESQ38708.1| hypothetical protein EUTSA_v10028628mg [Eutrema salsugineum] Length = 474 Score = 65.9 bits (159), Expect = 6e-09 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = -3 Query: 260 NAPRNPPWVQCCIKSYYVDKGDPWGSRNYQIFGTRLV 150 + PRNPPW++CCI SYY +K DPW +R Y+IFGTRL+ Sbjct: 437 STPRNPPWIECCILSYYTNKADPWNTRLYRIFGTRLL 473 >gb|AFQ21591.2| protection of telomeres 1a, partial [Aethionema saxatile] Length = 257 Score = 65.9 bits (159), Expect = 6e-09 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -3 Query: 266 DENAPRNPPWVQCCIKSYYVDKGDPWGSRNYQIFGTRLV 150 D PRNPPW++CCI SYY DK PW +R Y+IFGTRL+ Sbjct: 218 DGTGPRNPPWIECCILSYYTDKASPWETRFYRIFGTRLL 256 >gb|EEC77443.1| hypothetical protein OsI_16245 [Oryza sativa Indica Group] Length = 1489 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 2/40 (5%) Frame = -3 Query: 266 DENAP--RNPPWVQCCIKSYYVDKGDPWGSRNYQIFGTRL 153 +E AP RNPPW+ CC+KSY +DK DPWGSR Y+IFGT + Sbjct: 1448 EEGAPSNRNPPWIWCCLKSYRLDKNDPWGSRRYRIFGTEI 1487 >dbj|BAG94153.1| unnamed protein product [Oryza sativa Japonica Group] Length = 268 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 2/40 (5%) Frame = -3 Query: 266 DENAP--RNPPWVQCCIKSYYVDKGDPWGSRNYQIFGTRL 153 +E AP RNPPW+ CC+KSY +DK DPWGSR Y+IFGT + Sbjct: 227 EEGAPSNRNPPWIWCCLKSYRLDKNDPWGSRRYRIFGTEI 266