BLASTX nr result
ID: Akebia25_contig00025682
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00025682 (237 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC99534.1| hypothetical protein BAUCODRAFT_144944 [Baudoinia... 135 8e-30 gb|EMF14267.1| ribosomal protein S16 [Sphaerulina musiva SO2202] 132 5e-29 gb|EME83624.1| hypothetical protein MYCFIDRAFT_71168 [Pseudocerc... 131 9e-29 ref|XP_002839847.1| 40S ribosomal protein S19 [Tuber melanosporu... 131 1e-28 gb|EWC43566.1| 40S ribosomal protein S19 [Drechslerella stenobro... 130 1e-28 ref|XP_003171552.1| 40S ribosomal protein S19 [Arthroderma gypse... 130 2e-28 ref|XP_002846011.1| 40S ribosomal protein S19 [Arthroderma otae ... 130 2e-28 ref|XP_003233243.1| 40S ribosomal protein S19 [Trichophyton rubr... 130 2e-28 gb|ERS98511.1| 40S ribosomal protein S19 [Sporothrix schenckii A... 129 3e-28 gb|EON67231.1| 40S ribosomal protein S19 [Coniosporium apollinis... 129 3e-28 gb|EHL02628.1| putative 40S ribosomal protein S19 [Glarea lozoye... 129 3e-28 emb|CCX13681.1| Similar to 40S ribosomal protein S19; acc. no. P... 129 6e-28 gb|EME46902.1| hypothetical protein DOTSEDRAFT_70749 [Dothistrom... 129 6e-28 ref|XP_007290738.1| 40S ribosomal protein S19 [Marssonina brunne... 129 6e-28 ref|XP_002624771.1| 40S ribosomal protein S19 [Ajellomyces derma... 128 7e-28 gb|EEH42788.1| 40S ribosomal protein S19 [Paracoccidioides brasi... 128 9e-28 gb|ELR09732.1| 40S ribosomal protein S19 [Pseudogymnoascus destr... 127 1e-27 gb|EGX48524.1| hypothetical protein AOL_s00080g153 [Arthrobotrys... 127 1e-27 ref|XP_002792496.1| 40S ribosomal protein S19 [Paracoccidioides ... 127 1e-27 gb|EEH16260.1| 40S ribosomal protein S19-B [Paracoccidioides bra... 127 1e-27 >gb|EMC99534.1| hypothetical protein BAUCODRAFT_144944 [Baudoinia compniacensis UAMH 10762] Length = 150 Score = 135 bits (339), Expect = 8e-30 Identities = 62/70 (88%), Positives = 67/70 (95%) Frame = -2 Query: 212 MPGVSVRDVSAEKFIEAYAAFLKRQGKLPIPGWVDTVKTSHAKELPPQSIDWYYIRAAAI 33 MPGVSVRDV A+KFI AYAAFLKRQGKLPIPGW DTVKTSHAKELPPQSIDW+Y+RAAAI Sbjct: 1 MPGVSVRDVQADKFINAYAAFLKRQGKLPIPGWSDTVKTSHAKELPPQSIDWFYVRAAAI 60 Query: 32 ARHVYLRKTV 3 ARH+Y+RKTV Sbjct: 61 ARHIYMRKTV 70 >gb|EMF14267.1| ribosomal protein S16 [Sphaerulina musiva SO2202] Length = 150 Score = 132 bits (332), Expect = 5e-29 Identities = 61/70 (87%), Positives = 67/70 (95%) Frame = -2 Query: 212 MPGVSVRDVSAEKFIEAYAAFLKRQGKLPIPGWVDTVKTSHAKELPPQSIDWYYIRAAAI 33 MPGVSVRDV A+KFI+AYAAFLKRQGKLPIPGW DTVKTSHAKELPPQS DW+YIR+AA+ Sbjct: 1 MPGVSVRDVPADKFIDAYAAFLKRQGKLPIPGWSDTVKTSHAKELPPQSQDWFYIRSAAV 60 Query: 32 ARHVYLRKTV 3 ARH+YLRKTV Sbjct: 61 ARHIYLRKTV 70 >gb|EME83624.1| hypothetical protein MYCFIDRAFT_71168 [Pseudocercospora fijiensis CIRAD86] Length = 150 Score = 131 bits (330), Expect = 9e-29 Identities = 60/70 (85%), Positives = 67/70 (95%) Frame = -2 Query: 212 MPGVSVRDVSAEKFIEAYAAFLKRQGKLPIPGWVDTVKTSHAKELPPQSIDWYYIRAAAI 33 MPGVSVRDV A+KFI+AYAAFLKRQGKLPIPGW DTVKTSHAKELPPQS DW+Y+R+AAI Sbjct: 1 MPGVSVRDVPADKFIDAYAAFLKRQGKLPIPGWSDTVKTSHAKELPPQSQDWFYVRSAAI 60 Query: 32 ARHVYLRKTV 3 ARH+Y+RKTV Sbjct: 61 ARHIYMRKTV 70 >ref|XP_002839847.1| 40S ribosomal protein S19 [Tuber melanosporum Mel28] gi|295636053|emb|CAZ84038.1| unnamed protein product [Tuber melanosporum] Length = 152 Score = 131 bits (329), Expect = 1e-28 Identities = 61/70 (87%), Positives = 66/70 (94%) Frame = -2 Query: 212 MPGVSVRDVSAEKFIEAYAAFLKRQGKLPIPGWVDTVKTSHAKELPPQSIDWYYIRAAAI 33 MPGVSVRDV A+KFI+AYAAFLKRQGKL IPGWVDTVKT H KELPPQSIDW+YIRAAA+ Sbjct: 1 MPGVSVRDVDAQKFIDAYAAFLKRQGKLQIPGWVDTVKTGHMKELPPQSIDWFYIRAAAV 60 Query: 32 ARHVYLRKTV 3 ARHVYLRK+V Sbjct: 61 ARHVYLRKSV 70 >gb|EWC43566.1| 40S ribosomal protein S19 [Drechslerella stenobrocha 248] Length = 146 Score = 130 bits (328), Expect = 1e-28 Identities = 59/70 (84%), Positives = 66/70 (94%) Frame = -2 Query: 212 MPGVSVRDVSAEKFIEAYAAFLKRQGKLPIPGWVDTVKTSHAKELPPQSIDWYYIRAAAI 33 MPGVSVRDV A++FIEAYAAFLKRQGKLP+PGWVDTVKT + KELPPQSIDWYY+RAAA+ Sbjct: 1 MPGVSVRDVPAQEFIEAYAAFLKRQGKLPVPGWVDTVKTGNMKELPPQSIDWYYVRAAAV 60 Query: 32 ARHVYLRKTV 3 ARH+YLRK V Sbjct: 61 ARHIYLRKAV 70 >ref|XP_003171552.1| 40S ribosomal protein S19 [Arthroderma gypseum CBS 118893] gi|311343895|gb|EFR03098.1| 40S ribosomal protein S19 [Arthroderma gypseum CBS 118893] Length = 147 Score = 130 bits (327), Expect = 2e-28 Identities = 58/70 (82%), Positives = 68/70 (97%) Frame = -2 Query: 212 MPGVSVRDVSAEKFIEAYAAFLKRQGKLPIPGWVDTVKTSHAKELPPQSIDWYYIRAAAI 33 M GV+VRDV A+KF+EAY+AFLKRQGKLPIPGWVDTVKTS++KELPPQSIDWYY+RAAA+ Sbjct: 1 MGGVTVRDVDAQKFVEAYSAFLKRQGKLPIPGWVDTVKTSNSKELPPQSIDWYYVRAAAV 60 Query: 32 ARHVYLRKTV 3 ARH+Y+RKTV Sbjct: 61 ARHIYMRKTV 70 >ref|XP_002846011.1| 40S ribosomal protein S19 [Arthroderma otae CBS 113480] gi|238843399|gb|EEQ33061.1| 40S ribosomal protein S19 [Arthroderma otae CBS 113480] Length = 147 Score = 130 bits (327), Expect = 2e-28 Identities = 58/70 (82%), Positives = 68/70 (97%) Frame = -2 Query: 212 MPGVSVRDVSAEKFIEAYAAFLKRQGKLPIPGWVDTVKTSHAKELPPQSIDWYYIRAAAI 33 M GV+VRDV A+KF+EAY+AFLKRQGKLPIPGWVDTVKTS++KELPPQSIDWYY+RAAA+ Sbjct: 1 MGGVTVRDVDAQKFVEAYSAFLKRQGKLPIPGWVDTVKTSNSKELPPQSIDWYYVRAAAV 60 Query: 32 ARHVYLRKTV 3 ARH+Y+RKTV Sbjct: 61 ARHIYMRKTV 70 >ref|XP_003233243.1| 40S ribosomal protein S19 [Trichophyton rubrum CBS 118892] gi|326464549|gb|EGD90002.1| ribosomal protein S16 [Trichophyton rubrum CBS 118892] gi|326483354|gb|EGE07364.1| 40S ribosomal protein S19 [Trichophyton equinum CBS 127.97] gi|607880256|gb|EZF25128.1| 40S ribosomal protein S19 [Trichophyton rubrum MR850] gi|607888043|gb|EZF29099.1| 40S ribosomal protein S19 [Trichophyton interdigitale H6] gi|607906968|gb|EZF44159.1| 40S ribosomal protein S19 [Trichophyton rubrum CBS 100081] gi|607919067|gb|EZF54811.1| 40S ribosomal protein S19 [Trichophyton rubrum CBS 288.86] gi|607931110|gb|EZF65420.1| 40S ribosomal protein S19 [Trichophyton rubrum CBS 289.86] gi|607943093|gb|EZF76107.1| 40S ribosomal protein S19 [Trichophyton soudanense CBS 452.61] gi|607955138|gb|EZF86719.1| 40S ribosomal protein S19 [Trichophyton rubrum MR1448] gi|607967340|gb|EZF97504.1| 40S ribosomal protein S19 [Trichophyton rubrum MR1459] gi|607979392|gb|EZG08412.1| 40S ribosomal protein S19 [Trichophyton rubrum CBS 735.88] gi|607991386|gb|EZG19095.1| 40S ribosomal protein S19 [Trichophyton rubrum CBS 202.88] Length = 147 Score = 130 bits (326), Expect = 2e-28 Identities = 57/70 (81%), Positives = 68/70 (97%) Frame = -2 Query: 212 MPGVSVRDVSAEKFIEAYAAFLKRQGKLPIPGWVDTVKTSHAKELPPQSIDWYYIRAAAI 33 M G++VRDV A+KF+EAY+AFLKRQGKLPIPGWVDTVKTS++KELPPQSIDWYY+RAAA+ Sbjct: 1 MGGITVRDVDAQKFVEAYSAFLKRQGKLPIPGWVDTVKTSNSKELPPQSIDWYYVRAAAV 60 Query: 32 ARHVYLRKTV 3 ARH+Y+RKTV Sbjct: 61 ARHIYMRKTV 70 >gb|ERS98511.1| 40S ribosomal protein S19 [Sporothrix schenckii ATCC 58251] Length = 152 Score = 129 bits (325), Expect = 3e-28 Identities = 60/70 (85%), Positives = 65/70 (92%) Frame = -2 Query: 212 MPGVSVRDVSAEKFIEAYAAFLKRQGKLPIPGWVDTVKTSHAKELPPQSIDWYYIRAAAI 33 M GVSVRDV A+KFI AYAAFLKRQGKLPIPGWVDTVKT HAKELPPQ IDW+Y+RAA++ Sbjct: 1 MGGVSVRDVDAQKFIVAYAAFLKRQGKLPIPGWVDTVKTGHAKELPPQDIDWFYVRAASV 60 Query: 32 ARHVYLRKTV 3 ARHVYLRKTV Sbjct: 61 ARHVYLRKTV 70 >gb|EON67231.1| 40S ribosomal protein S19 [Coniosporium apollinis CBS 100218] Length = 150 Score = 129 bits (325), Expect = 3e-28 Identities = 60/68 (88%), Positives = 64/68 (94%) Frame = -2 Query: 206 GVSVRDVSAEKFIEAYAAFLKRQGKLPIPGWVDTVKTSHAKELPPQSIDWYYIRAAAIAR 27 GVSVRDV A KFI AYAAFLKRQGKLPIPGWVDTVKTSH+KELPPQ IDW+YIRAAA+AR Sbjct: 4 GVSVRDVEANKFISAYAAFLKRQGKLPIPGWVDTVKTSHSKELPPQDIDWFYIRAAAVAR 63 Query: 26 HVYLRKTV 3 HVY+RKTV Sbjct: 64 HVYMRKTV 71 >gb|EHL02628.1| putative 40S ribosomal protein S19 [Glarea lozoyensis 74030] gi|512196985|gb|EPE25821.1| Winged helix DNA-binding protein [Glarea lozoyensis ATCC 20868] Length = 150 Score = 129 bits (325), Expect = 3e-28 Identities = 61/68 (89%), Positives = 65/68 (95%) Frame = -2 Query: 206 GVSVRDVSAEKFIEAYAAFLKRQGKLPIPGWVDTVKTSHAKELPPQSIDWYYIRAAAIAR 27 GVSVRDV A+KFIEAYAAFLKRQGKLPIPGWVDTVKT AKELPPQSIDW+Y+RAAAIAR Sbjct: 4 GVSVRDVDAQKFIEAYAAFLKRQGKLPIPGWVDTVKTGPAKELPPQSIDWFYVRAAAIAR 63 Query: 26 HVYLRKTV 3 HVY+RKTV Sbjct: 64 HVYMRKTV 71 >emb|CCX13681.1| Similar to 40S ribosomal protein S19; acc. no. P27073 [Pyronema omphalodes CBS 100304] Length = 148 Score = 129 bits (323), Expect = 6e-28 Identities = 58/70 (82%), Positives = 66/70 (94%) Frame = -2 Query: 212 MPGVSVRDVSAEKFIEAYAAFLKRQGKLPIPGWVDTVKTSHAKELPPQSIDWYYIRAAAI 33 MPGVSVRDV A+KFIEAYAAFLKRQGKLP+PGWVDTVKT + KELPPQS+DW+Y+RAAA+ Sbjct: 1 MPGVSVRDVDAQKFIEAYAAFLKRQGKLPVPGWVDTVKTGNYKELPPQSMDWFYVRAAAV 60 Query: 32 ARHVYLRKTV 3 ARH YLRK+V Sbjct: 61 ARHTYLRKSV 70 >gb|EME46902.1| hypothetical protein DOTSEDRAFT_70749 [Dothistroma septosporum NZE10] Length = 151 Score = 129 bits (323), Expect = 6e-28 Identities = 59/70 (84%), Positives = 66/70 (94%) Frame = -2 Query: 212 MPGVSVRDVSAEKFIEAYAAFLKRQGKLPIPGWVDTVKTSHAKELPPQSIDWYYIRAAAI 33 MPGVSVRDV A+KFI+AYAAFLKRQGKLPIPGW DTVK SHAKELPPQS DW+YIRAA++ Sbjct: 1 MPGVSVRDVPADKFIDAYAAFLKRQGKLPIPGWSDTVKLSHAKELPPQSQDWFYIRAASV 60 Query: 32 ARHVYLRKTV 3 ARH+Y+RKTV Sbjct: 61 ARHIYVRKTV 70 >ref|XP_007290738.1| 40S ribosomal protein S19 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406866572|gb|EKD19612.1| 40S ribosomal protein S19 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 151 Score = 129 bits (323), Expect = 6e-28 Identities = 60/68 (88%), Positives = 65/68 (95%) Frame = -2 Query: 206 GVSVRDVSAEKFIEAYAAFLKRQGKLPIPGWVDTVKTSHAKELPPQSIDWYYIRAAAIAR 27 G+SVRDV A+KFIEAYAAFLKRQGKLPIPGWVDTVKT AKELPPQSIDW+Y+RAA+IAR Sbjct: 4 GISVRDVDAQKFIEAYAAFLKRQGKLPIPGWVDTVKTGPAKELPPQSIDWFYVRAASIAR 63 Query: 26 HVYLRKTV 3 HVYLRKTV Sbjct: 64 HVYLRKTV 71 >ref|XP_002624771.1| 40S ribosomal protein S19 [Ajellomyces dermatitidis SLH14081] gi|239596016|gb|EEQ78597.1| 30S ribosomal protein S19e [Ajellomyces dermatitidis SLH14081] gi|239609595|gb|EEQ86582.1| 30S ribosomal protein S19e [Ajellomyces dermatitidis ER-3] gi|327350165|gb|EGE79022.1| 40S ribosomal protein S19 [Ajellomyces dermatitidis ATCC 18188] gi|531986544|gb|EQL37131.1| 40S ribosomal protein S19 [Ajellomyces dermatitidis ATCC 26199] Length = 147 Score = 128 bits (322), Expect = 7e-28 Identities = 60/70 (85%), Positives = 65/70 (92%) Frame = -2 Query: 212 MPGVSVRDVSAEKFIEAYAAFLKRQGKLPIPGWVDTVKTSHAKELPPQSIDWYYIRAAAI 33 M GV+VRDV A+KFIEAY+AFLKRQGKLPIPGWVDTVKTS ELPPQSIDWYYIRAA+I Sbjct: 1 MGGVTVRDVDAQKFIEAYSAFLKRQGKLPIPGWVDTVKTSRGNELPPQSIDWYYIRAASI 60 Query: 32 ARHVYLRKTV 3 ARH+YLRKTV Sbjct: 61 ARHIYLRKTV 70 >gb|EEH42788.1| 40S ribosomal protein S19 [Paracoccidioides brasiliensis Pb18] Length = 919 Score = 128 bits (321), Expect = 9e-28 Identities = 61/72 (84%), Positives = 66/72 (91%) Frame = -2 Query: 218 ANMPGVSVRDVSAEKFIEAYAAFLKRQGKLPIPGWVDTVKTSHAKELPPQSIDWYYIRAA 39 A M GV+VRDV A+KFI AY+AFLKRQGKLPIPGWVDTVKTS A ELPPQSIDWYYIRAA Sbjct: 772 AIMGGVTVRDVDAQKFIAAYSAFLKRQGKLPIPGWVDTVKTSRANELPPQSIDWYYIRAA 831 Query: 38 AIARHVYLRKTV 3 +IARH+YLRKTV Sbjct: 832 SIARHIYLRKTV 843 >gb|ELR09732.1| 40S ribosomal protein S19 [Pseudogymnoascus destructans 20631-21] Length = 150 Score = 127 bits (320), Expect = 1e-27 Identities = 60/68 (88%), Positives = 64/68 (94%) Frame = -2 Query: 206 GVSVRDVSAEKFIEAYAAFLKRQGKLPIPGWVDTVKTSHAKELPPQSIDWYYIRAAAIAR 27 GVSVRDV A+KFI AY+AFLKRQGKLPIPGWVDTVKT AKELPPQSIDWYY+RAA+IAR Sbjct: 4 GVSVRDVDAQKFINAYSAFLKRQGKLPIPGWVDTVKTGAAKELPPQSIDWYYVRAASIAR 63 Query: 26 HVYLRKTV 3 HVYLRKTV Sbjct: 64 HVYLRKTV 71 >gb|EGX48524.1| hypothetical protein AOL_s00080g153 [Arthrobotrys oligospora ATCC 24927] Length = 145 Score = 127 bits (320), Expect = 1e-27 Identities = 59/70 (84%), Positives = 64/70 (91%) Frame = -2 Query: 212 MPGVSVRDVSAEKFIEAYAAFLKRQGKLPIPGWVDTVKTSHAKELPPQSIDWYYIRAAAI 33 MPGVSVRDV A+ FIEAYAAFLKRQGKLP+PGWVDTVKT + KELPPQSIDWYY RAAA+ Sbjct: 1 MPGVSVRDVPAQDFIEAYAAFLKRQGKLPVPGWVDTVKTGNMKELPPQSIDWYYTRAAAV 60 Query: 32 ARHVYLRKTV 3 ARH+YLRK V Sbjct: 61 ARHIYLRKHV 70 >ref|XP_002792496.1| 40S ribosomal protein S19 [Paracoccidioides sp. 'lutzii' Pb01] gi|226279166|gb|EEH34732.1| 40S ribosomal protein S19 [Paracoccidioides sp. 'lutzii' Pb01] Length = 146 Score = 127 bits (320), Expect = 1e-27 Identities = 60/70 (85%), Positives = 65/70 (92%) Frame = -2 Query: 212 MPGVSVRDVSAEKFIEAYAAFLKRQGKLPIPGWVDTVKTSHAKELPPQSIDWYYIRAAAI 33 M GV+VRDV A+KFI AY+AFLKRQGKLPIPGWVDTVKTS A ELPPQSIDWYYIRAA+I Sbjct: 1 MGGVTVRDVDAQKFIAAYSAFLKRQGKLPIPGWVDTVKTSRANELPPQSIDWYYIRAASI 60 Query: 32 ARHVYLRKTV 3 ARH+YLRKTV Sbjct: 61 ARHIYLRKTV 70 >gb|EEH16260.1| 40S ribosomal protein S19-B [Paracoccidioides brasiliensis Pb03] Length = 145 Score = 127 bits (320), Expect = 1e-27 Identities = 60/70 (85%), Positives = 65/70 (92%) Frame = -2 Query: 212 MPGVSVRDVSAEKFIEAYAAFLKRQGKLPIPGWVDTVKTSHAKELPPQSIDWYYIRAAAI 33 M GV+VRDV A+KFI AY+AFLKRQGKLPIPGWVDTVKTS A ELPPQSIDWYYIRAA+I Sbjct: 1 MGGVTVRDVDAQKFIAAYSAFLKRQGKLPIPGWVDTVKTSRANELPPQSIDWYYIRAASI 60 Query: 32 ARHVYLRKTV 3 ARH+YLRKTV Sbjct: 61 ARHIYLRKTV 70