BLASTX nr result
ID: Akebia25_contig00017926
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00017926 (462 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006852788.1| hypothetical protein AMTR_s00033p00148790 [A... 74 3e-11 ref|XP_002282596.2| PREDICTED: zinc finger matrin-type protein 2... 67 2e-09 ref|NP_001238021.1| uncharacterized protein LOC100527057 [Glycin... 67 3e-09 gb|AFK41101.1| unknown [Lotus japonicus] 67 3e-09 ref|XP_007205919.1| hypothetical protein PRUPE_ppa011609mg [Prun... 66 4e-09 ref|XP_003521665.2| PREDICTED: zinc finger matrin-type protein 2... 66 6e-09 ref|XP_004158724.1| PREDICTED: zinc finger matrin-type protein 2... 66 6e-09 ref|XP_002512496.1| zinc finger protein, putative [Ricinus commu... 66 6e-09 ref|XP_007163328.1| hypothetical protein PHAVU_001G225500g [Phas... 65 7e-09 gb|EXC13337.1| Zinc finger matrin-type protein 2 [Morus notabilis] 64 2e-08 gb|EXC05645.1| Zinc finger matrin-type protein 2 [Morus notabilis] 64 2e-08 ref|XP_006375726.1| hypothetical protein POPTR_0013s01160g [Popu... 64 2e-08 ref|XP_002319487.2| hypothetical protein POPTR_0013s01160g [Popu... 64 2e-08 ref|XP_006433514.1| hypothetical protein CICLE_v10002528mg [Citr... 64 2e-08 ref|XP_002882434.1| hypothetical protein ARALYDRAFT_896672 [Arab... 64 3e-08 ref|NP_566257.1| C2H2 and C2HC zinc fingers superfamily protein ... 64 3e-08 gb|AAF26078.1|AC012393_4 hypothetical protein [Arabidopsis thali... 64 3e-08 ref|XP_004144761.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger ... 62 6e-08 ref|XP_006298585.1| hypothetical protein CARUB_v10014668mg [Caps... 62 8e-08 ref|XP_006298584.1| hypothetical protein CARUB_v10014668mg [Caps... 62 8e-08 >ref|XP_006852788.1| hypothetical protein AMTR_s00033p00148790 [Amborella trichopoda] gi|548856402|gb|ERN14255.1| hypothetical protein AMTR_s00033p00148790 [Amborella trichopoda] Length = 205 Score = 73.6 bits (179), Expect = 3e-11 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 462 MSMRVERASLQQVQDRFEILKKQKVEGSFTEQDLDDRIL 346 MSMRVERASLQQVQDRFEILKK+KV GSFTEQDLDDRIL Sbjct: 115 MSMRVERASLQQVQDRFEILKKRKVAGSFTEQDLDDRIL 153 >ref|XP_002282596.2| PREDICTED: zinc finger matrin-type protein 2-like [Vitis vinifera] gi|296089759|emb|CBI39578.3| unnamed protein product [Vitis vinifera] Length = 204 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 462 MSMRVERASLQQVQDRFEILKKQKVEGSFTEQDLDDRIL 346 MSMRVERASLQQVQ+RFE+LKK++ GSFTEQDLD+RIL Sbjct: 116 MSMRVERASLQQVQERFEVLKKRRTPGSFTEQDLDERIL 154 >ref|NP_001238021.1| uncharacterized protein LOC100527057 [Glycine max] gi|255631460|gb|ACU16097.1| unknown [Glycine max] Length = 210 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 462 MSMRVERASLQQVQDRFEILKKQKVEGSFTEQDLDDRIL 346 MSMRVERASLQQVQ+RFE+LKK+K GSFTEQDLD+RIL Sbjct: 115 MSMRVERASLQQVQERFEVLKKRKDVGSFTEQDLDERIL 153 >gb|AFK41101.1| unknown [Lotus japonicus] Length = 202 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 462 MSMRVERASLQQVQDRFEILKKQKVEGSFTEQDLDDRIL 346 MSMRVERASLQQVQDRFE+LKK+K GSFTEQDLD+ IL Sbjct: 115 MSMRVERASLQQVQDRFEVLKKRKTLGSFTEQDLDELIL 153 >ref|XP_007205919.1| hypothetical protein PRUPE_ppa011609mg [Prunus persica] gi|462401561|gb|EMJ07118.1| hypothetical protein PRUPE_ppa011609mg [Prunus persica] Length = 203 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 462 MSMRVERASLQQVQDRFEILKKQKVEGSFTEQDLDDRIL 346 MSMRVERASLQQVQ+RFE LKK+K +G+FTEQDLD+RIL Sbjct: 115 MSMRVERASLQQVQERFEKLKKRKTDGTFTEQDLDERIL 153 >ref|XP_003521665.2| PREDICTED: zinc finger matrin-type protein 2-like [Glycine max] Length = 202 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 462 MSMRVERASLQQVQDRFEILKKQKVEGSFTEQDLDDRIL 346 MSMRVERASL+QVQ+RFE+LKK+K GSFTEQDLD+RIL Sbjct: 115 MSMRVERASLEQVQERFEVLKKRKDVGSFTEQDLDERIL 153 >ref|XP_004158724.1| PREDICTED: zinc finger matrin-type protein 2-like [Cucumis sativus] Length = 202 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = -1 Query: 462 MSMRVERASLQQVQDRFEILKKQKVEGSFTEQDLDDRIL 346 MSMRVERASL+QVQ+RFE+LKK+K GSFTEQDL++RIL Sbjct: 114 MSMRVERASLEQVQERFEVLKKRKTPGSFTEQDLEERIL 152 >ref|XP_002512496.1| zinc finger protein, putative [Ricinus communis] gi|223548457|gb|EEF49948.1| zinc finger protein, putative [Ricinus communis] Length = 202 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 462 MSMRVERASLQQVQDRFEILKKQKVEGSFTEQDLDDRIL 346 MSMRVERASLQQVQ+RFE LKK+K GSFTEQDLD+RIL Sbjct: 113 MSMRVERASLQQVQERFESLKKRKSPGSFTEQDLDERIL 151 >ref|XP_007163328.1| hypothetical protein PHAVU_001G225500g [Phaseolus vulgaris] gi|561036792|gb|ESW35322.1| hypothetical protein PHAVU_001G225500g [Phaseolus vulgaris] Length = 201 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 462 MSMRVERASLQQVQDRFEILKKQKVEGSFTEQDLDDRIL 346 MSMRVERASL+QVQ+RFE+LKK+K GSFTEQDLD+RIL Sbjct: 115 MSMRVERASLKQVQERFEVLKKRKDVGSFTEQDLDERIL 153 >gb|EXC13337.1| Zinc finger matrin-type protein 2 [Morus notabilis] Length = 392 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = -1 Query: 462 MSMRVERASLQQVQDRFEILKKQKVEGSFTEQDLDDRIL 346 MSMRVERASL+QVQ+RFE+LKK+K GSF+EQDLD+RIL Sbjct: 193 MSMRVERASLKQVQERFEVLKKRKDPGSFSEQDLDERIL 231 >gb|EXC05645.1| Zinc finger matrin-type protein 2 [Morus notabilis] Length = 191 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = -1 Query: 462 MSMRVERASLQQVQDRFEILKKQKVEGSFTEQDLDDRIL 346 MSMRVERASL+QVQ+RFE+LKK+K GSF+EQDLD+RIL Sbjct: 103 MSMRVERASLKQVQERFEVLKKRKDPGSFSEQDLDERIL 141 >ref|XP_006375726.1| hypothetical protein POPTR_0013s01160g [Populus trichocarpa] gi|550324665|gb|ERP53523.1| hypothetical protein POPTR_0013s01160g [Populus trichocarpa] Length = 190 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 462 MSMRVERASLQQVQDRFEILKKQKVEGSFTEQDLDDRIL 346 MSMRVERASLQQVQ+RFE LKK++ GSFTEQDLD+RIL Sbjct: 114 MSMRVERASLQQVQERFEKLKKRREPGSFTEQDLDERIL 152 >ref|XP_002319487.2| hypothetical protein POPTR_0013s01160g [Populus trichocarpa] gi|550324664|gb|EEE95410.2| hypothetical protein POPTR_0013s01160g [Populus trichocarpa] Length = 202 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 462 MSMRVERASLQQVQDRFEILKKQKVEGSFTEQDLDDRIL 346 MSMRVERASLQQVQ+RFE LKK++ GSFTEQDLD+RIL Sbjct: 114 MSMRVERASLQQVQERFEKLKKRREPGSFTEQDLDERIL 152 >ref|XP_006433514.1| hypothetical protein CICLE_v10002528mg [Citrus clementina] gi|568836294|ref|XP_006472180.1| PREDICTED: zinc finger matrin-type protein 2-like [Citrus sinensis] gi|557535636|gb|ESR46754.1| hypothetical protein CICLE_v10002528mg [Citrus clementina] Length = 202 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/39 (76%), Positives = 37/39 (94%) Frame = -1 Query: 462 MSMRVERASLQQVQDRFEILKKQKVEGSFTEQDLDDRIL 346 MSMRVERASL QV++RFE+LKK+KV GSF+EQDLD+RI+ Sbjct: 113 MSMRVERASLDQVRERFELLKKRKVPGSFSEQDLDERII 151 >ref|XP_002882434.1| hypothetical protein ARALYDRAFT_896672 [Arabidopsis lyrata subsp. lyrata] gi|297328274|gb|EFH58693.1| hypothetical protein ARALYDRAFT_896672 [Arabidopsis lyrata subsp. lyrata] Length = 202 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -1 Query: 462 MSMRVERASLQQVQDRFEILKKQKVEGSFTEQDLDDRI 349 MSMRVER+SL+QVQ+RFE+LKK+K G+FTEQDLD+RI Sbjct: 113 MSMRVERSSLEQVQERFEVLKKRKTPGTFTEQDLDERI 150 >ref|NP_566257.1| C2H2 and C2HC zinc fingers superfamily protein [Arabidopsis thaliana] gi|14517383|gb|AAK62582.1| AT3g05760/F10A16_5 [Arabidopsis thaliana] gi|15450543|gb|AAK96449.1| AT3g05760/F10A16_5 [Arabidopsis thaliana] gi|332640772|gb|AEE74293.1| C2H2 and C2HC zinc fingers superfamily protein [Arabidopsis thaliana] Length = 202 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -1 Query: 462 MSMRVERASLQQVQDRFEILKKQKVEGSFTEQDLDDRI 349 MSMRVER+SL+QVQ+RFE+LKK+K G+FTEQDLD+RI Sbjct: 113 MSMRVERSSLEQVQERFEVLKKRKAPGTFTEQDLDERI 150 >gb|AAF26078.1|AC012393_4 hypothetical protein [Arabidopsis thaliana] Length = 180 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -1 Query: 462 MSMRVERASLQQVQDRFEILKKQKVEGSFTEQDLDDRI 349 MSMRVER+SL+QVQ+RFE+LKK+K G+FTEQDLD+RI Sbjct: 110 MSMRVERSSLEQVQERFEVLKKRKAPGTFTEQDLDERI 147 >ref|XP_004144761.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger matrin-type protein 2-like [Cucumis sativus] Length = 202 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -1 Query: 462 MSMRVERASLQQVQDRFEILKKQKVEGSFTEQDLDDRIL 346 MSMRVERASL+QV +RFE+LKK++ GSFTEQDL++RIL Sbjct: 114 MSMRVERASLEQVXERFEVLKKRETSGSFTEQDLEERIL 152 >ref|XP_006298585.1| hypothetical protein CARUB_v10014668mg [Capsella rubella] gi|482567294|gb|EOA31483.1| hypothetical protein CARUB_v10014668mg [Capsella rubella] Length = 202 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/38 (73%), Positives = 36/38 (94%) Frame = -1 Query: 462 MSMRVERASLQQVQDRFEILKKQKVEGSFTEQDLDDRI 349 MSMRVER+SL+QVQ+RFE+LKK+K G+F+EQDLD+RI Sbjct: 113 MSMRVERSSLEQVQERFEVLKKRKTPGTFSEQDLDERI 150 >ref|XP_006298584.1| hypothetical protein CARUB_v10014668mg [Capsella rubella] gi|482567293|gb|EOA31482.1| hypothetical protein CARUB_v10014668mg [Capsella rubella] Length = 202 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/38 (73%), Positives = 36/38 (94%) Frame = -1 Query: 462 MSMRVERASLQQVQDRFEILKKQKVEGSFTEQDLDDRI 349 MSMRVER+SL+QVQ+RFE+LKK+K G+F+EQDLD+RI Sbjct: 113 MSMRVERSSLEQVQERFEVLKKRKTPGTFSEQDLDERI 150