BLASTX nr result
ID: Akebia25_contig00017757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00017757 (405 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006836801.1| hypothetical protein AMTR_s00099p00022390 [A... 60 4e-07 gb|EMT26220.1| Queuine tRNA-ribosyltransferase subunit qtrtd1 [A... 55 8e-06 gb|EMS57961.1| Queuine tRNA-ribosyltransferase subunit qtrtd1 [T... 55 8e-06 gb|EYU36621.1| hypothetical protein MIMGU_mgv1a007695mg [Mimulus... 55 1e-05 ref|XP_003573536.1| PREDICTED: queuine tRNA-ribosyltransferase s... 55 1e-05 >ref|XP_006836801.1| hypothetical protein AMTR_s00099p00022390 [Amborella trichopoda] gi|548839365|gb|ERM99654.1| hypothetical protein AMTR_s00099p00022390 [Amborella trichopoda] Length = 397 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -3 Query: 403 NTHHYLGFFRMIREAIKREEFDLFCQRFVESRRELAVAVA 284 NTHHYLGFFRMIREAIKR+EF+ F + F+E RR VA A Sbjct: 356 NTHHYLGFFRMIREAIKRDEFESFQKSFLEGRRSYLVAHA 395 >gb|EMT26220.1| Queuine tRNA-ribosyltransferase subunit qtrtd1 [Aegilops tauschii] Length = 396 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = -3 Query: 403 NTHHYLGFFRMIREAIKREEFDLFCQRFVESRRELAVAVA 284 NTHHYL FFR IREAIK EFD+F ++FVE+RR A A Sbjct: 356 NTHHYLRFFRSIREAIKAGEFDIFWKQFVENRRSQIAAAA 395 >gb|EMS57961.1| Queuine tRNA-ribosyltransferase subunit qtrtd1 [Triticum urartu] Length = 346 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = -3 Query: 403 NTHHYLGFFRMIREAIKREEFDLFCQRFVESRRELAVAVA 284 NTHHYL FFR IREAIK EFD+F ++FVE+RR A A Sbjct: 306 NTHHYLRFFRSIREAIKAGEFDIFWKQFVENRRSQIAAAA 345 >gb|EYU36621.1| hypothetical protein MIMGU_mgv1a007695mg [Mimulus guttatus] Length = 398 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -3 Query: 403 NTHHYLGFFRMIREAIKREEFDLFCQRFVESRRELAVAVACS 278 N HHYLGFFRMIREAI R +F+ F Q+FV +RR+ + A S Sbjct: 356 NAHHYLGFFRMIREAINRGKFNEFRQKFVATRRDYIIGAASS 397 >ref|XP_003573536.1| PREDICTED: queuine tRNA-ribosyltransferase subunit QTRTD1-like [Brachypodium distachyon] Length = 396 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/40 (70%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = -3 Query: 403 NTHHYLGFFRMIREAIKREEFDLFCQRFVESRR-ELAVAV 287 NTHHYL FFR IREAIK EFDLF ++FVE+RR ++A AV Sbjct: 356 NTHHYLHFFRSIREAIKIGEFDLFWKQFVENRRSQIAAAV 395