BLASTX nr result
ID: Akebia25_contig00017756
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00017756 (289 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006836801.1| hypothetical protein AMTR_s00099p00022390 [A... 58 1e-06 >ref|XP_006836801.1| hypothetical protein AMTR_s00099p00022390 [Amborella trichopoda] gi|548839365|gb|ERM99654.1| hypothetical protein AMTR_s00099p00022390 [Amborella trichopoda] Length = 397 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = -3 Query: 287 NTHHYLGFFRMIREAIKREEFDLFCQRFVESRRELAVVVA 168 NTHHYLGFFRMIREAIKR+EF+ F + F+E RR V A Sbjct: 356 NTHHYLGFFRMIREAIKRDEFESFQKSFLEGRRSYLVAHA 395