BLASTX nr result
ID: Akebia25_contig00017532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00017532 (362 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS83353.1| hypothetical protein PFICI_05229 [Pestalotiopsis ... 76 4e-12 >gb|ETS83353.1| hypothetical protein PFICI_05229 [Pestalotiopsis fici W106-1] Length = 67 Score = 76.3 bits (186), Expect = 4e-12 Identities = 41/65 (63%), Positives = 45/65 (69%), Gaps = 2/65 (3%) Frame = +2 Query: 155 DQYRPQE-GIAHEST-TTAATHGQPQFTNSFAPGQDSAQLEAPFGSPDGARQRSGSKDYS 328 +QYRPQE G H+ T TT A H QPQFTNSFAPGQ A E P D R+RSGSKD+S Sbjct: 4 EQYRPQEDGYTHDVTGTTGAHHEQPQFTNSFAPGQTEAHYENPI---DDERERSGSKDFS 60 Query: 329 ATDEW 343 TDEW Sbjct: 61 QTDEW 65